KEGG   Arachis duranensis: 107492283Help
Entry
107492283         CDS       T04300                                 

Definition
(RefSeq) aldehyde dehydrogenase family 2 member B4, mitochondrial
  KO
K00128  aldehyde dehydrogenase (NAD+) [EC:1.2.1.3]
Organism
adu  Arachis duranensis
Pathway
adu00010  Glycolysis / Gluconeogenesis
adu00053  Ascorbate and aldarate metabolism
adu00071  Fatty acid degradation
adu00280  Valine, leucine and isoleucine degradation
adu00310  Lysine degradation
adu00330  Arginine and proline metabolism
adu00340  Histidine metabolism
adu00380  Tryptophan metabolism
adu00410  beta-Alanine metabolism
adu00561  Glycerolipid metabolism
adu00620  Pyruvate metabolism
adu00903  Limonene and pinene degradation
adu01100  Metabolic pathways
adu01110  Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:adu00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    107492283
   00053 Ascorbate and aldarate metabolism
    107492283
   00620 Pyruvate metabolism
    107492283
  09103 Lipid metabolism
   00071 Fatty acid degradation
    107492283
   00561 Glycerolipid metabolism
    107492283
  09105 Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    107492283
   00310 Lysine degradation
    107492283
   00330 Arginine and proline metabolism
    107492283
   00340 Histidine metabolism
    107492283
   00380 Tryptophan metabolism
    107492283
  09106 Metabolism of other amino acids
   00410 beta-Alanine metabolism
    107492283
  09109 Metabolism of terpenoids and polyketides
   00903 Limonene and pinene degradation
    107492283
Enzymes [BR:adu01000]
 1. Oxidoreductases
  1.2  Acting on the aldehyde or oxo group of donors
   1.2.1  With NAD+ or NADP+ as acceptor
    1.2.1.3  aldehyde dehydrogenase (NAD+)
     107492283
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Aldedh
Motif
Other DBs
NCBI-GeneID: 107492283
NCBI-ProteinID: XP_015968772
LinkDB All DBs
Position
A01
AA seq 540 aa AA seqDB search
MAARRLSWLLSRSLSAASGADSFLHSLGRNSGGGCRKLKRFSTAAAVDEVIIPQVQINYT
QHLIDGKFVDSASGKTFPTYDPRTGEVIAQVAEGDAEDINRAVAAARKAFDEGPWPKMTA
YERCRILLRFADLVEKHSKELAALETWNNGKPYEQSFNDELPLFVRLFHYYAGWADKIHG
MTVPADGKYHVQTLHEPIGVAGQIIPWNFPLIMFAWKVGPALACGNTVILKTAEQTPLTA
LYVAKLFHEAGLPPGVLNIVSGFGPTAGAALASHMDVDKLAFTGSTDTGKIVLELAARSN
LKPVTLELGGKSPFIVCHDADVDHAVEQAHFALFFNQGQCCCAGSRTFVHERIYDEFLEK
SKKRALRRVVGDPFKKGVEQGPQIDTEQFEKVLRYIRSGIESNATLECGGQRLGSKGFFI
EPTVFSNVKDDMLIAKDEIFGPVQSILKFKDIEEVIKRANATRYGLAAGVFTKNVHTANT
LMRALRVGTVWINCFDVFDAAIPFGGYKMSGIGREKGIYSLNNYLQIKAVVEPLKNPAWI
NT seq 1623 nt NT seq  +upstreamnt  +downstreamnt
atggcagctcgtagactttcatggcttctctcacgctccctttctgctgcttctggagct
gactcctttcttcactcactcggaagaaactctggcggagggtgcagaaaattgaagagg
tttagcacagctgcagcggttgatgaagtgattattccacaagttcaaatcaattacact
cagcatctcatagatggcaagtttgtggattctgcatcagggaagacttttccaacctat
gacccgcgcacaggggaagttatagctcaagtagctgaaggagacgctgaagatatcaac
cgcgccgtcgccgctgcgcgaaaggcctttgatgaaggaccctggcctaaaatgactgct
tatgaaaggtgtcggatattgctgcggtttgctgatttggtggagaagcatagtaaagag
cttgcagctctagagacatggaacaatggaaagccttatgagcaatctttcaacgacgaa
ttgccattgtttgtgcgtttgttccactactatgctggttgggctgataaaattcacggg
atgaccgtaccggctgatggaaaatatcacgtgcaaacattgcatgaaccaattggggtt
gcaggacaaatcataccttggaattttcctctaattatgtttgcttggaaagttggtcca
gctctggcttgtggtaacactgtcattttgaagactgctgagcaaacacccctcaccgct
ctttatgtggctaaactctttcatgaggctggtcttccaccaggtgttctgaatatagtt
tctggatttggcccaactgctggtgcagctcttgcaagtcacatggacgttgacaagcta
gcatttactggatcaacagacactggaaaaattgtgcttgaattggctgcaagaagcaat
ctgaagcctgtgacattggagctgggaggcaaatcaccttttattgtgtgtcatgatgct
gatgttgaccacgctgttgaacaagcacactttgctctcttctttaatcagggacaatgt
tgctgtgctgggtctcgaacctttgtacatgagcgtatctatgatgagttcttggagaag
tcaaagaaacgtgctttgagacgcgttgttggtgatccattcaagaagggtgttgaacaa
ggccctcagattgacacagaacaatttgagaaagtgcttaggtacataagatctggaatt
gaaagcaatgctacccttgaatgtgggggtcagcgattgggctcaaaaggcttcttcatc
gagccaactgttttctccaatgttaaggacgatatgctgatagccaaagacgaaatattc
gggccggttcagtccatcttgaaattcaaggacattgaagaagtaataaagagagcaaat
gcaacacgatatggactagcagcaggagtgttcacaaagaacgtacacacagcaaacaca
ttgatgagggcactgagagttggaacggtttggatcaactgtttcgatgtattcgacgct
gccattccctttggaggctacaagatgagtggcattgggagggagaaaggaatctacagt
ctcaacaactaccttcagatcaaagctgttgttgaaccactcaagaatcctgcttggatt
taa

DBGET integrated database retrieval system