KEGG   Acinetobacter defluvii: DJ533_16950
Entry
DJ533_16950       CDS       T05474                                 

Definition
(GenBank) alpha/beta fold hydrolase
  KO
K10216  2-hydroxymuconate-semialdehyde hydrolase [EC:3.7.1.9]
Organism
adv  Acinetobacter defluvii
Pathway
adv00362  Benzoate degradation
adv00622  Xylene degradation
adv00643  Styrene degradation
adv01100  Metabolic pathways
adv01120  Microbial metabolism in diverse environments
adv01220  Degradation of aromatic compounds
Module
adv_M00569  Catechol meta-cleavage, catechol => acetyl-CoA / 4-methylcatechol => propanoyl-CoA
Brite
KEGG Orthology (KO) [BR:adv00001]
 09100 Metabolism
  09111 Xenobiotics biodegradation and metabolism
   00362 Benzoate degradation
    DJ533_16950
   00622 Xylene degradation
    DJ533_16950
   00643 Styrene degradation
    DJ533_16950
Enzymes [BR:adv01000]
 3. Hydrolases
  3.7  Acting on carbon-carbon bonds
   3.7.1  In ketonic substances
    3.7.1.9  2-hydroxymuconate-6-semialdehyde hydrolase
     DJ533_16950
SSDB
Motif
Pfam: Abhydrolase_1 Abhydrolase_6 Hydrolase_4 Abhydrolase_2 Peptidase_S9 Esterase FSH1 UPF0227
Other DBs
NCBI-ProteinID: AWL30134
UniProt: A0A2S2FGR0
LinkDB
Position
complement(3017466..3018326)
AA seq 286 aa
MSTVQIPDYKTDSFFGLEDKWIETAEGELTHYHEVGEGTPVLFLHGSGTGVSAAANWWLN
LPQIGEQARCIAIDTIGYGQTVVAPNTAYGIRAWVDHAVRTLDALGIEKTWLVGNSLGGW
LSFQLALDYPERVLGIVSMGTGGAKQTAALKAHANPVLTEEGIKKTLSMFVVDKDLITDE
LVKVRYEAAKNDYASDRLMDVVGARDRDRFEFPLDFEKMKDINVPVLLIHGVQDVVIPVS
RTWDILNTVPNADAHIFSQCGHWSQVEKADEFNTVIKNYLAARGVK
NT seq 861 nt   +upstreamnt  +downstreamnt
atgagcactgttcaaatccctgattataaaactgattctttctttggattagaggataaa
tggattgaaactgctgaaggcgaattaacacactatcatgaagtgggtgaaggaacgccg
gtattgtttttgcatggttcaggtacaggtgtatctgcggctgcaaattggtggttaaac
ttaccacaaattggtgagcaagcacggtgtatcgccattgatacgattggttatggtcaa
acggttgttgcaccgaatactgcttatgggattcgtgcttgggtcgatcatgcagtgcgt
actctagatgctttagggattgaaaaaacgtggttagtgggtaactctttgggtggttgg
ttatctttccaattggcattggattatccagagcgtgttttaggcattgtgtcgatgggg
acaggtggtgcaaaacaaacggctgcattgaaagcgcatgctaacccagtgttaactgaa
gaaggcatcaagaaaactttatctatgtttgtggttgataaagacttaattaccgatgaa
ttggtaaaagtgcgttatgaagctgcgaaaaatgactatgcttctgaccgtttgatggat
gtcgtgggtgcacgtgaccgtgatcgttttgaatttccacttgattttgaaaaaatgaaa
gacattaatgtgccagttttattgattcatggtgtacaagatgtggtgattcctgtgtca
cggacttgggatattttaaatactgttccaaatgcagatgcgcacattttcagtcaatgt
ggtcactggtcacaagttgaaaaagctgacgaatttaacacggtgattaaaaattatttg
gcggcacgtggcgtgaaataa

DBGET integrated database retrieval system