KEGG   Aeromonas sp. ASNIH3: C2U39_05520
Entry
C2U39_05520       CDS       T05427                                 

Gene name
holA
Definition
(GenBank) DNA polymerase III subunit delta
  KO
K02340  DNA polymerase III subunit delta [EC:2.7.7.7]
Organism
aea  Aeromonas sp. ASNIH3
Pathway
aea03030  DNA replication
aea03430  Mismatch repair
aea03440  Homologous recombination
Brite
KEGG Orthology (KO) [BR:aea00001]
 09120 Genetic Information Processing
  09124 Replication and repair
   03030 DNA replication
    C2U39_05520 (holA)
   03430 Mismatch repair
    C2U39_05520 (holA)
   03440 Homologous recombination
    C2U39_05520 (holA)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03032 DNA replication proteins [BR:aea03032]
    C2U39_05520 (holA)
   03400 DNA repair and recombination proteins [BR:aea03400]
    C2U39_05520 (holA)
Enzymes [BR:aea01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.7  Nucleotidyltransferases
    2.7.7.7  DNA-directed DNA polymerase
     C2U39_05520 (holA)
DNA replication proteins [BR:aea03032]
 Prokaryotic type
  DNA Replication Elongation Factors
   Elongation factors (bacterial)
    DNA polymerase III holoenzyme
     C2U39_05520 (holA)
DNA repair and recombination proteins [BR:aea03400]
 Prokaryotic type
  SSBR (single strand breaks repair)
   MMR (mismatch excision repair)
    DNA polymerase III holoenzyme
     C2U39_05520 (holA)
SSDB
Motif
Pfam: DNA_pol3_delta DNA_pol3_delt_C DNA_pol3_gamma3
Other DBs
NCBI-ProteinID: AUV11687
UniProt: A0A2I8QZN7
LinkDB
Position
complement(1104378..1105412)
AA seq 344 aa
MRVYPEQFADHLKAGLKPCYLIFGDEPLLKLEAVDAVRQVARKQGFDERHSFVVEQGLDW
NQVYDACQAMSLFSARQIIELELPAKIDKDLAARISDIGKQLHPDLLLVLSGPRLNQTQM
KAAWFDKLSQSGTYVPVNHPEPRFFPRWMSARFQRFGLKALPDAVNFMCHAYEGNLLAAS
QEIEKLTLLSPPQPISVAYLQETIIRHAHFTPFQLVDTLLEGKVNRAQRILLALRAEGTE
PGMLAWTLCRELEQLTELALAARAGQPLVEHFSRLRIWQSRQQLIQQALTRLPFPKIRQL
WQLMAQLDHAQRHFDTEQAWLMLQTIALGFRDGTPLPLLETESC
NT seq 1035 nt   +upstreamnt  +downstreamnt
atgagagtctatcccgagcagtttgcggatcatctcaaggcagggctcaagccctgctat
ctcatttttggggacgagcccctgctcaaactggaagctgtcgacgccgtgcgtcaggtg
gcacgcaaacagggcttcgatgagcgccacagcttcgtggtggaacaggggctggactgg
aaccaggtctacgatgcctgccaggccatgagcctgttctcggcccgccagatcatcgag
ctggagctgcccgccaagatcgacaaggatctcgccgcccgcatcagcgatattggcaag
cagctccaccccgacctgctgctggtgctctcgggcccccgcctcaaccagacccagatg
aaggcggcctggttcgacaagctgagccagagcggcacctatgtgccggtcaaccacccc
gagccccgcttcttcccgcgctggatgagcgcccgctttcagcgcttcggcctcaaggca
ctgccggatgcggtcaacttcatgtgccacgcctacgagggcaacctgctggccgcgagc
caggagatcgagaagctgaccctgctctcgccgccccagcccatcagcgtcgcctatctg
caggagaccatcatccgccacgcccacttcacccccttccagctcgtcgataccctgctg
gaaggaaaggtgaaccgggcccagcgcatcctgctggccctgcgcgccgagggcaccgaa
cccggcatgctggcctggaccctgtgccgcgagctggagcagctcaccgagctggcgctg
gccgcccgcgccggacagcccctggtggagcatttcagccgcctgcgcatctggcagagt
cgccagcaactcatccagcaggcgctgacccggcttcccttccccaagatccggcaactc
tggcaactgatggcccagctggaccatgcccagcgccatttcgacaccgagcaggcctgg
ctgatgctgcaaaccatcgccctcggctttcgtgacggaaccccgctccccctgctggag
acggaatcatgctga

KEGG   Aeromonas sp. ASNIH3: C2U39_07380
Entry
C2U39_07380       CDS       T05427                                 

Definition
(GenBank) DNA polymerase III subunit epsilon
  KO
K02342  DNA polymerase III subunit epsilon [EC:2.7.7.7]
Organism
aea  Aeromonas sp. ASNIH3
Pathway
aea03030  DNA replication
aea03430  Mismatch repair
aea03440  Homologous recombination
Brite
KEGG Orthology (KO) [BR:aea00001]
 09120 Genetic Information Processing
  09124 Replication and repair
   03030 DNA replication
    C2U39_07380
   03430 Mismatch repair
    C2U39_07380
   03440 Homologous recombination
    C2U39_07380
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03032 DNA replication proteins [BR:aea03032]
    C2U39_07380
   03400 DNA repair and recombination proteins [BR:aea03400]
    C2U39_07380
Enzymes [BR:aea01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.7  Nucleotidyltransferases
    2.7.7.7  DNA-directed DNA polymerase
     C2U39_07380
DNA replication proteins [BR:aea03032]
 Prokaryotic type
  DNA Replication Elongation Factors
   Elongation factors (bacterial)
    DNA polymerase III holoenzyme
     C2U39_07380
DNA repair and recombination proteins [BR:aea03400]
 Prokaryotic type
  SSBR (single strand breaks repair)
   MMR (mismatch excision repair)
    DNA polymerase III holoenzyme
     C2U39_07380
SSDB
Motif
Pfam: RNase_T DUF5051 DNA_pol_A_exo1
Other DBs
NCBI-ProteinID: AUV12013
UniProt: A0A2I8R0T8
LinkDB
Position
1497966..1498700
AA seq 244 aa
MSTPQLNRQIILDTETTGMNTAGGPVYLGHRIIEIGCVEVINRKLTGNHFHVYIKPDRLV
DPEAIAVHGITDAFLADKPSFSQIADDFIEFIRGAELIAHNAPFDVSFMDYEFSKLGLNF
KTADICGITDTLAMARDLFPGKRNNLDVLCDRYGIDNSHRTLHGALLDAEILADVYLLMT
GGQTKLNLASETSESETSQDTGIRRLESNRPPLRVVRASDEVAAVHEARLDLVQKKGGAC
LWRQ
NT seq 735 nt   +upstreamnt  +downstreamnt
atgagcacaccccaactgaatcgccagatcattctggataccgaaaccaccggcatgaac
accgcgggcggccccgtttatcttgggcaccgcatcatcgagatcggctgtgtggaggtg
atcaaccgcaaactcaccggcaaccatttccacgtctacatcaagccggatcggctggtg
gaccccgaggccatcgccgtgcacggcatcacggatgccttcctggcggacaagccctct
tttagccagatagcggacgatttcatcgagttcattcgcggcgccgagctcatcgcccac
aacgccccctttgacgtgagcttcatggactatgagttcagcaagctcggtctgaacttc
aagacggcggatatctgcggcatcacggataccctggcgatggcgcgggatctcttcccg
ggcaagcgcaacaacctggacgtgttgtgcgatcgctacggcatcgacaactctcaccgt
accctgcacggcgccttgctcgatgcggagatcctggcggacgtctacctcctgatgacg
ggtggccagaccaaactcaatctggcgagcgaaaccagcgagagcgagaccagccaggat
accggcattcgtcgtctggagagcaatcgcccgccgctcagggtggttcgcgcgagcgac
gaggtggcggctgtccatgaagcgaggctggatctggtacagaaaaaaggaggtgcctgc
ctgtggcggcaatga

KEGG   Aeromonas sp. ASNIH3: C2U39_09860
Entry
C2U39_09860       CDS       T05427                                 

Definition
(GenBank) 3'-5' exonuclease
  KO
K02342  DNA polymerase III subunit epsilon [EC:2.7.7.7]
Organism
aea  Aeromonas sp. ASNIH3
Pathway
aea03030  DNA replication
aea03430  Mismatch repair
aea03440  Homologous recombination
Brite
KEGG Orthology (KO) [BR:aea00001]
 09120 Genetic Information Processing
  09124 Replication and repair
   03030 DNA replication
    C2U39_09860
   03430 Mismatch repair
    C2U39_09860
   03440 Homologous recombination
    C2U39_09860
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03032 DNA replication proteins [BR:aea03032]
    C2U39_09860
   03400 DNA repair and recombination proteins [BR:aea03400]
    C2U39_09860
Enzymes [BR:aea01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.7  Nucleotidyltransferases
    2.7.7.7  DNA-directed DNA polymerase
     C2U39_09860
DNA replication proteins [BR:aea03032]
 Prokaryotic type
  DNA Replication Elongation Factors
   Elongation factors (bacterial)
    DNA polymerase III holoenzyme
     C2U39_09860
DNA repair and recombination proteins [BR:aea03400]
 Prokaryotic type
  SSBR (single strand breaks repair)
   MMR (mismatch excision repair)
    DNA polymerase III holoenzyme
     C2U39_09860
SSDB
Motif
Pfam: RNase_T DUF5051
Other DBs
NCBI-ProteinID: AUV12454
UniProt: A0A2I8R2A2
LinkDB
Position
complement(2067653..2068279)
AA seq 208 aa
MWMHWRRRWLGRTFREGEFAPLFARPAGDEWVALDFETTSLDPALAEIVSIGAVRIRGNR
IETGDALAIRVQAPASLSAGSVVIHGLRHQDLQQGMALEPALRALLEFIGPRELVGYHIA
YDLRILNLACQRLWGLTLPQRGIEVSRLYHDHLYRRYPDAAIDLHLAAICRHLALPALPP
HDALSDAVTAALVFVRLHQGGPLAYPKV
NT seq 627 nt   +upstreamnt  +downstreamnt
atgtggatgcactggcgccgccgctggcttggcaggacgtttcgggagggggagtttgcc
ccgctctttgcccgccctgctggcgacgagtgggtggcgctggacttcgagaccaccagc
ctggatccggcgctggcggagatcgtctccatcggggcggtgcgtatccggggcaaccgg
atagagacgggcgatgcccttgccatccgggtccaggctcccgccagcctgagcgccggg
tccgtggtgatccacggcctgcgccatcaggatctgcaacagggcatggcactggagccc
gcgctgcgcgcgctgctggagttcatcggcccccgtgagctggtggggtatcacatcgcc
tatgacctgcgcattctcaacctcgcctgccaacggctgtgggggctcaccctcccccag
cgcggcatcgaggtgagccgcctctatcacgatcacctctatcgccgctatcccgacgcc
gccatcgatctgcacctggccgcgatctgtcgccatctggcgctaccagccctgcccccc
cacgacgccctgagcgatgccgtcaccgccgcccttgtctttgtacgcctgcatcagggc
ggccccctggcttatcccaaagtctaa

KEGG   Aeromonas sp. ASNIH3: C2U39_10680
Entry
C2U39_10680       CDS       T05427                                 

Definition
(GenBank) DNA polymerase III subunit gamma/tau
  KO
K02343  DNA polymerase III subunit gamma/tau [EC:2.7.7.7]
Organism
aea  Aeromonas sp. ASNIH3
Pathway
aea03030  DNA replication
aea03430  Mismatch repair
aea03440  Homologous recombination
Brite
KEGG Orthology (KO) [BR:aea00001]
 09120 Genetic Information Processing
  09124 Replication and repair
   03030 DNA replication
    C2U39_10680
   03430 Mismatch repair
    C2U39_10680
   03440 Homologous recombination
    C2U39_10680
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03032 DNA replication proteins [BR:aea03032]
    C2U39_10680
   03400 DNA repair and recombination proteins [BR:aea03400]
    C2U39_10680
Enzymes [BR:aea01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.7  Nucleotidyltransferases
    2.7.7.7  DNA-directed DNA polymerase
     C2U39_10680
DNA replication proteins [BR:aea03032]
 Prokaryotic type
  DNA Replication Elongation Factors
   Elongation factors (bacterial)
    DNA polymerase III holoenzyme
     C2U39_10680
DNA repair and recombination proteins [BR:aea03400]
 Prokaryotic type
  SSBR (single strand breaks repair)
   MMR (mismatch excision repair)
    DNA polymerase III holoenzyme
     C2U39_10680
SSDB
Motif
Pfam: DNA_pol3_delta2 DNA_pol3_tau_5 DNA_pol3_gamma3 AAA RuvB_N AAA_16 AAA_5 ResIII AAA_22 AAA_18 AAA_14 Rad17 AAA_30 TsaE AAA_19 VirE Mg_chelatase TniB SKI ERAP1_C DUF815 AAA_24 PIF1 T2SSE PatG_D ABC_tran Herpes_Helicase
Other DBs
NCBI-ProteinID: AUV12587
UniProt: A0A2I8R281
LinkDB
Position
2229540..2232023
AA seq 827 aa
MSYQVLARKWRPHTFEQVVGQQHVLTALTNALDQGRLHHAYLLSGTRGVGKTTIARILAK
SLNCEQGISSHPCGVCDTCREIDQGNFVDLLEIDAASRTKVEDTRELLDNVQYRPARGRF
KVYLIDEVHMLSRHSFNALLKTLEEPPPYVKFLLATTDPQKLPITILSRCLQFHLKSLDQ
TQIARQLEWVLDQEGQPFEPRALLALAKAADGSMRDALSLTDQALAHGNGSVRLESVLTM
LGTLDHHHLHQLLEAVLRQDAPATMAKITEIATLGPDFDQLHAELEALLHRVAMAQLLPA
SVQEQGADADALLQLAGAMSPEEVQLCYQIVLGGRKDLPWAPDGRTALEMTCLRMLAFSP
RREVVHPANLAAQPLMTGHSGVMAAARESASLLPGKPQGAEPAPAASAAPQAPAAPASVL
AAEHVAPAPKAEEGAVLDPLFAEQDELLREAERMGYEAVVPASPPAAEPASAPLAADDAG
QTQQVEVQGEDVTISSTSSMQSLLGKRNLLRSRLRGEQSANGAPPRVTPVKPVAATKPAP
AMPAVATSPQAEVQPAARPEMPGQGSAMQTGYDDLPPLDAYEEGASDYEEYLNQGFDEGF
ASAPLPTRAVTSAQPAPATMAPPSQEDLPPWDLGADVGSADAAAPAIVAMVPAAPPVAAS
EPQPAIALMETIDWDALESDAQPEEEGEVARLIPSSLLVNCGDAWAELIARTGVGGRLRQ
LAINAVMTREGNRVSLLLKPEQRHLVSDKARADLAEIIGPELGGPVHIDVTLGSDPARET
PLEIEHRLYLGVREQVSRDLAADPNVQFLQQRFGAVLHPESIEPLSR
NT seq 2484 nt   +upstreamnt  +downstreamnt
atgagctatcaggttttggcgcgcaaatggcgcccccatacgtttgaacaagtggtcggc
cagcaacatgtgctgacggccctgaccaatgccctggatcaggggcggcttcatcacgcc
tatctgctgagcgggacccgcggggtgggcaagaccaccatcgcccgcatcctggccaag
agcctcaactgcgagcaggggataagcagccatccatgcggtgtgtgcgatacctgccgc
gagatcgatcagggcaatttcgtcgatctgctggaaatcgatgcggcgtcccgcaccaag
gtggaagacacccgcgaactgctcgacaacgtgcagtaccgtccggcccgtggtcgtttc
aaggtgtacctcatcgatgaagtgcacatgctgtcgcgccacagcttcaatgcgctgctc
aaaaccctggaagagccgcccccttatgtgaaattcctgctggccaccacggatccgcag
aagctccccatcaccatcctctcgcgctgcctgcagtttcatctcaagagtctggatcag
acccagattgccaggcagctcgaatgggtgctggaccaggagggccaacccttcgagcct
cgcgccctgctggccctggccaaggcggccgacggcagcatgcgcgatgccctgagcctc
accgatcaggcgttggcccacggcaacggtagcgtgcgcctggagagcgtgctcaccatg
ctggggaccctcgatcatcaccacctgcaccagttgctggaggcagtgctgcgccaggat
gcacccgccaccatggccaagatcaccgagattgcgaccctggggccggatttcgaccag
cttcacgccgagctggaagccttgctccaccgggtggccatggcgcaactgctgcctgcg
agcgtgcaggagcagggggcggatgccgatgccttgctgcagctcgccggagccatgagc
ccggaagaggtgcagctctgctatcaaatcgtgctgggggggcgcaaggatctgccctgg
gcccctgacgggcgcaccgcactggagatgacctgtctgcggatgctggccttctctccc
cggcgcgaggtggtccatcccgccaacctggcggcccaacctctcatgacagggcactcc
ggcgtgatggcggctgcgagggaaagtgcgtcgctcctgccgggaaagccccagggggct
gagccggccccggctgccagcgcagcaccacaggctcccgccgcgccagcatcggtcctt
gcggccgagcacgtcgcccccgcacccaaggcggaggagggcgcagtgctggatccgctc
tttgccgagcaggatgagctgctgcgtgaggccgaacggatgggctacgaggccgtggtg
cccgccagtccgcctgcagcagagccagcctctgcgccgttggcggcggatgacgccggg
cagacgcagcaggttgaggttcaaggggaagacgtcaccatctcttcgacctccagcatg
cagagcctgcttggcaagcgcaatctgctgcgaagccgcctgcgtggcgagcagagtgca
aacggcgcgcccccccgggtcacccccgtcaaacccgtggccgcgaccaaaccggcccct
gcgatgcctgccgtcgcgacttcgccccaggccgaggtgcaaccagcggcgcggcccgag
atgccggggcagggttctgccatgcaaacggggtatgacgacctgccccctctggatgcc
tatgaagagggggccagtgactacgaagagtatctgaatcaggggtttgacgaggggttt
gccagtgccccgttgcccacgcgggcagtgacttccgcccagccagctcccgccaccatg
gctcctccttcgcaggaagatctgccgccctgggatctgggtgctgacgtcggcagcgcg
gatgcggcggcacctgcgattgtcgctatggtgcctgccgcgcctccagtggccgccagc
gagcctcagcccgccattgcattgatggagaccatcgactgggatgccctggagagcgac
gcccagcccgaggaggagggggaggtcgcccgtctgatcccctcgtccttgttggtcaat
tgcggggacgcctgggccgaactcatcgcccgcaccggggtgggtggtcggctgcgtcaa
ctggccatcaacgcggtgatgacccgggaaggcaatcgggtctccctgctgctcaaaccc
gagcagcgccatctggtgagcgacaaggcccgcgccgatctggccgagatcatcggtccc
gagctgggcggcccggttcacatcgatgtgaccctgggctcggatcccgcgcgggagacg
ccgctcgagatagagcatcgtctctatctcggggtgcgtgaacaggtgagccgggatctg
gcggcggatcccaacgtacaattcttgcagcagcgtttcggcgccgtgctccatcccgag
agcatcgaacccctgagtcgctga

KEGG   Aeromonas sp. ASNIH3: C2U39_10955
Entry
C2U39_10955       CDS       T05427                                 

Gene name
holB
Definition
(GenBank) DNA polymerase III subunit delta'
  KO
K02341  DNA polymerase III subunit delta' [EC:2.7.7.7]
Organism
aea  Aeromonas sp. ASNIH3
Pathway
aea03030  DNA replication
aea03430  Mismatch repair
aea03440  Homologous recombination
Brite
KEGG Orthology (KO) [BR:aea00001]
 09120 Genetic Information Processing
  09124 Replication and repair
   03030 DNA replication
    C2U39_10955 (holB)
   03430 Mismatch repair
    C2U39_10955 (holB)
   03440 Homologous recombination
    C2U39_10955 (holB)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03032 DNA replication proteins [BR:aea03032]
    C2U39_10955 (holB)
   03400 DNA repair and recombination proteins [BR:aea03400]
    C2U39_10955 (holB)
Enzymes [BR:aea01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.7  Nucleotidyltransferases
    2.7.7.7  DNA-directed DNA polymerase
     C2U39_10955 (holB)
DNA replication proteins [BR:aea03032]
 Prokaryotic type
  DNA Replication Elongation Factors
   Elongation factors (bacterial)
    DNA polymerase III holoenzyme
     C2U39_10955 (holB)
DNA repair and recombination proteins [BR:aea03400]
 Prokaryotic type
  SSBR (single strand breaks repair)
   MMR (mismatch excision repair)
    DNA polymerase III holoenzyme
     C2U39_10955 (holB)
SSDB
Motif
Pfam: DNA_pol3_delta2 DNApol3-delta_C AAA AAA_5 Mg_chelatase DNA_pol3_delta QueC BPL_N
Other DBs
NCBI-ProteinID: AUV12634
UniProt: A0A2I8R2S3
LinkDB
Position
2291232..2292179
AA seq 315 aa
MYPWLIPDWHALSETARAGRLGHAWLLLGDPGLGKEQLAEQLARLHLCQHPQRGEPCGQC
HSCQLFEKGHHPDLGTLGPEGKTIGVEAIREICSRLQSTSQLGRGKVVIIQEAERMTESA
ANALLKTLEEPAGDSLLLLIASRVSRLLPTILSRCHKHVCQLPSEGETLAWLAEQGHQAT
QAQVRICQGAPLRVLSYIEAQQDDARRALLDGFVSLASAPTRAANVCDQLAEDNQVRLHW
LQLFLCDALKLQAGCGHHQLAMPDLASLSQQLAERHSSERLLEAEQQLVVLKETCQPGQL
SNPTIHLMNWLNRWL
NT seq 948 nt   +upstreamnt  +downstreamnt
atgtatccctggctgatcccggattggcatgccttgagcgagacggcccgggccggacgg
ctcggccacgcctggttgctgctaggcgatcccggccttggcaaggagcagcttgcagag
caactggcgcgactgcacctgtgtcagcatccacaacgaggtgagccctgcggtcagtgc
cactcctgccagctttttgagaaggggcatcacccggatcttgggaccctggggcccgag
ggcaagaccataggtgtcgaagccatccgggagatttgcagccgcctccagagcacgtcc
cagcttggtcgcggcaaggtggtgatcattcaggaggcggagcgcatgacggagtctgcc
gccaatgctttgctgaagacgctggaagagccggctggcgacagtctgttgctgctcatc
gcatcccgggtatctcgcctgctccccaccatcttgagccgttgtcacaaacatgtctgc
cagctcccctctgaaggtgagacccttgcctggctcgccgagcagggccatcaggccacc
caggcccaggtgcggatctgccagggtgcgccgctgcgggtgctgagctatatcgaagca
cagcaagatgatgccagacgggcattgctcgacggatttgtctcgctggcatcggccccc
acccgtgcggcgaatgtctgcgaccagttggccgaggataatcaggtccggctgcactgg
ttgcagctcttcttgtgcgatgccctcaagcttcaggctggctgcggccatcatcaactg
gcgatgccggatcttgcatcactcagccagcaactggctgagagacactccagcgaacgg
ctcctggaagctgaacagcagctggttgtgctgaaagagacttgtcagccagggcagctt
tccaatcccaccatccatttgatgaactggctcaatcgctggttataa

KEGG   Aeromonas sp. ASNIH3: C2U39_16510
Entry
C2U39_16510       CDS       T05427                                 

Definition
(GenBank) DNA polymerase III subunit alpha
  KO
K02337  DNA polymerase III subunit alpha [EC:2.7.7.7]
Organism
aea  Aeromonas sp. ASNIH3
Pathway
aea03030  DNA replication
aea03430  Mismatch repair
aea03440  Homologous recombination
Brite
KEGG Orthology (KO) [BR:aea00001]
 09120 Genetic Information Processing
  09124 Replication and repair
   03030 DNA replication
    C2U39_16510
   03430 Mismatch repair
    C2U39_16510
   03440 Homologous recombination
    C2U39_16510
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03032 DNA replication proteins [BR:aea03032]
    C2U39_16510
   03400 DNA repair and recombination proteins [BR:aea03400]
    C2U39_16510
Enzymes [BR:aea01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.7  Nucleotidyltransferases
    2.7.7.7  DNA-directed DNA polymerase
     C2U39_16510
DNA replication proteins [BR:aea03032]
 Prokaryotic type
  DNA Replication Elongation Factors
   Elongation factors (bacterial)
    DNA polymerase III holoenzyme
     C2U39_16510
DNA repair and recombination proteins [BR:aea03400]
 Prokaryotic type
  SSBR (single strand breaks repair)
   MMR (mismatch excision repair)
    DNA polymerase III holoenzyme
     C2U39_16510
SSDB
Motif
Pfam: DNA_pol3_alpha DNA_pol3_finger PHP HHH_6 tRNA_anti-codon
Other DBs
NCBI-ProteinID: AUV14867
UniProt: A0A2I8R8P9
LinkDB
Position
complement(3526932..3530411)
AA seq 1159 aa
MADPRFIHLRVHSDFSMVDGLQKIGPIVSAAAANNMPALALTDQMNMCGLVRFYGSAHGK
GIKPLVGADFWVQSDELGDEQFRLTLLAMDNDGYQNITLLISRGYQRGHVQGRPVIDKAW
LGEHAKGVIVLSGGREGDVGKFLLKGNRQMVEHCLAFYQTHFPDAYYLELLRTGRPDEEV
YLHMAVAIATEFELPVVATNEVVFLTADDFDAHEIRVAIHDGYTLMDKRRPRRYSPQQYL
RSQEEMAELFADIPEALENTVEIAKRCNVTVRLGEYFLPNFPTGDMTTEDFLVMKSKEGL
EERLAFLFPDPAVRAERRPEYDERLDIELKVINQMGFPGYFLIVMEFIQWSKDNGIPVGP
GRGSGAGSLVAYALKITDLDPLEFDLLFERFLNPERVSMPDFDVDFCMDRRDEVIDHVSE
MYGREAVSQIITFGSMAAKAVVRDVGRVLGHAYGFVDRISKLIPPDPGMTLAKAFEAEPK
LPELYEQDEEVKDLIDMARRLEGVVRNAGKHAGGVVIAPTKITDFAPLYCDDEGHHPVTQ
FDKNDVEYAGLVKFDFLGLRTLTIIDWALGMINPRLAKEGKPPVDIAAIPIDDKKSFALL
QRFETTAVFQLESRGMKDLIKRLQPDCFEDMIALVALFRPGPLQSGMVDNFIERKHGKEA
ISYPDEKWQHESLKPILEPTYGIILYQEQVMQIAQTLAGYTLGGADMLRRAMGKKKPEEM
AKQRAGFEEGAVKNGVDGELAMKIFDLVEKFAGYGFNKSHSAAYALVSYQTLWLKTHFPA
EFMAAVMTADMDNTDKIVTLVDECQRMGLTVIPPDVNTGRYRFSVNEDGHIVYGIGAVKG
VGEGPIEAILEARDRDGPFRDLFDFCNRVDIKKLNKRVMEKLILSGAMDRLGPHRAALMA
TLEEAMRAAEQHAKAQAVGQVDMFGVLTEEIDDVKKAFANVPHWPDKVWLEGERETLGLY
LTGHPINQYSSELRRYTSGRLCDLHPTSRDTVTTAAGLVIAARSMVTKRGNKMGIFTLDD
RSGRLDVTLFSEALEKYEELMQKDRILVVSGQVSFDDFSGGLKMSARELLDINDARERFA
RAIRISLDEQRIDERFFPRLCEILEPARAGVCPVQVNYRRPGSRVRLTLGTEWRVTPTDQ
LIDDLRVLLGRERVELVFD
NT seq 3480 nt   +upstreamnt  +downstreamnt
atggctgatccccgtttcatccacctgagggtgcactccgacttctccatggtcgacggc
ctgcagaagatcggtcccatcgtctccgcagccgccgccaacaacatgccggccctggcc
ctgacggaccagatgaacatgtgcggcctggtgcgcttctacggctctgcccacggcaag
gggatcaagcccctggtcggggcggatttctgggtgcagagcgacgagcttggggacgag
cagtttcgcctcaccctgctcgccatggacaacgacggctaccagaacatcaccctgctc
atctcccgcggctatcagcgcggtcatgtgcaggggcgccccgtcatcgacaaggcctgg
cttggcgaacatgccaagggggtgatcgtcctctccggcgggcgcgagggggatgtgggc
aagttcctgctcaaaggcaaccgccagatggtggagcattgcctcgccttctaccagacc
cacttcccggatgcctactaccttgagctgctgcgtaccggccgcccggacgaggaggtc
tacctgcacatggcggtggccattgccaccgagttcgaactgccggtggtggccaccaac
gaggtggtgttcctcaccgccgatgacttcgatgcccacgagatccgggtcgccatccac
gacggctacaccctgatggacaagcgccgaccgcgccgctacagcccccagcagtacctg
cgcagtcaggaggagatggcggagctgtttgccgacatcccggaagccctggaaaacacg
gtggagatcgccaagcgctgcaacgtgacggtgcgccttggcgagtatttcctgcccaac
ttccccaccggcgacatgaccaccgaagacttcctggtcatgaagtcgaaggaagggctg
gaggagcggctggccttcctgttcccggatccggcggtgcgggccgagcgccgtcccgag
tatgacgagcgtctcgacatcgagctcaaagtgatcaaccagatgggcttcccgggttac
ttcctcatcgtgatggagtttatccagtggtccaaggacaacggcatccccgtcggtccg
ggccggggctcgggggcggggtcgctggtggcttatgccctcaagatcaccgatctcgat
ccgctggaatttgacctgctgttcgaacgtttcctgaaccccgagcgggtctccatgccc
gacttcgacgtcgacttctgcatggacaggcgcgacgaggtgatcgatcacgtctccgag
atgtacggccgggaggcggtatcccagatcatcaccttcggcagcatggcggccaaggcg
gtggtacgggacgtcggccgggtgctgggccacgcctacggctttgtcgatcgcatctcc
aagctgatcccgcccgaccccggcatgaccctcgccaaggcgttcgaggccgaacccaag
ctgcccgagctctacgagcaggacgaggaggtcaaggacctcatcgacatggcccgccgc
ctggaaggggtggtgcgcaacgccggcaagcacgccggtggcgtggtgatcgcgcccacc
aagatcaccgacttcgcgccgctctattgcgacgacgaggggcatcacccggtcacccag
ttcgacaagaacgacgtggagtacgcgggcctagtgaagttcgacttcctggggctgcgc
accctcaccatcatcgattgggcccttggcatgataaacccccgtcttgccaaagagggc
aagccgccggtggacatcgccgccatccccatcgatgacaagaagtcgttcgccctcttg
cagcgtttcgagaccacggcggtgttccagctcgaatcccgcggcatgaaggacctcatc
aagcggctgcagcccgactgcttcgaagacatgatcgcgctggtggccctgttccgtccg
ggcccgctccagtcgggcatggtggacaacttcatcgagcgcaagcacggcaaggaggcc
atctcctacccggacgagaagtggcagcacgaaagcctcaaacccatactcgagcccacc
tacggcatcatcctctaccaggagcaggtgatgcagatcgcccagaccctggcggggtat
accctgggtggcgcggacatgctgcgccgggccatgggcaagaaaaaacccgaagagatg
gccaagcagcgggcgggcttcgaggagggggcggtcaagaacggcgtcgacggcgaactg
gcgatgaagatcttcgatctggtggagaagtttgcgggctacggcttcaacaagtcccac
tccgctgcctatgcgctggtctcctaccagaccctctggctcaagacccatttcccggcg
gagttcatggcggcggtgatgaccgcggacatggacaacaccgacaagatagtgaccctg
gtggacgagtgtcagcgcatggggctgaccgtgataccgccggacgtcaacaccggtcgc
taccgcttcagcgtcaacgaggacggccatatcgtctacggcatcggcgcggtgaaggga
gtaggggaagggcccatcgaggcgatcctggaggcgcgggatcgggacggtccgttccgc
gacctgttcgacttctgcaaccgggtcgacatcaagaagctcaacaagcgggtgatggag
aagctcatcctctccggcgccatggacaggctcggcccccaccgcgccgccctgatggcg
accctggaggaggcgatgcgcgccgccgagcagcacgccaaggcccaggcggtggggcag
gtcgacatgttcggcgtgctcacggaggagatcgacgacgtcaagaaggcgttcgccaac
gtgccgcactggcccgacaaggtgtggctggaaggggagcgcgagaccctcgggctctac
ctcaccggtcaccccatcaaccagtacagcagcgagctgcggcgctacacctcgggccga
ctgtgcgatctgcatcccacctcccgggatacggtgaccacggcggcggggttggtgatc
gcggcgcgcagcatggtgaccaagcgcggcaacaagatggggatcttcaccctggacgac
agatccggccgtctggatgtgacccttttcagtgaagcgctggaaaaatacgaagaattg
atgcaaaaagaccgtattttagtggtttctggacaggtcagctttgatgacttctccggt
ggccttaaaatgtcggcccgcgagttgctggatatcaacgatgcgagggagcgttttgcc
agggcaatccgcatctccctcgatgaacaacgcattgacgagcgctttttcccgcgtttg
tgcgagattttggagcccgcccgtgccggagtctgtccggttcaggtaaactatcgtcgc
cccggttcccgggtgcgattgacgctcggtaccgagtggcgggtgacgcccaccgatcaa
ctgatagatgacttgcgagtcctgcttggacgagagcgggttgaattggtttttgattag

KEGG   Aeromonas sp. ASNIH3: C2U39_18365
Entry
C2U39_18365       CDS       T05427                                 

Definition
(GenBank) hypothetical protein
  KO
K02344  DNA polymerase III subunit psi [EC:2.7.7.7]
Organism
aea  Aeromonas sp. ASNIH3
Pathway
aea03030  DNA replication
aea03430  Mismatch repair
aea03440  Homologous recombination
Brite
KEGG Orthology (KO) [BR:aea00001]
 09120 Genetic Information Processing
  09124 Replication and repair
   03030 DNA replication
    C2U39_18365
   03430 Mismatch repair
    C2U39_18365
   03440 Homologous recombination
    C2U39_18365
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03032 DNA replication proteins [BR:aea03032]
    C2U39_18365
   03400 DNA repair and recombination proteins [BR:aea03400]
    C2U39_18365
Enzymes [BR:aea01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.7  Nucleotidyltransferases
    2.7.7.7  DNA-directed DNA polymerase
     C2U39_18365
DNA replication proteins [BR:aea03032]
 Prokaryotic type
  DNA Replication Elongation Factors
   Elongation factors (bacterial)
    DNA polymerase III holoenzyme
     C2U39_18365
DNA repair and recombination proteins [BR:aea03400]
 Prokaryotic type
  SSBR (single strand breaks repair)
   MMR (mismatch excision repair)
    DNA polymerase III holoenzyme
     C2U39_18365
SSDB
Motif
Pfam: DNA_III_psi
Other DBs
NCBI-ProteinID: AUV13944
UniProt: A0A2I8R6J9
LinkDB
Position
3933542..3933979
AA seq 145 aa
MQDPLLDPLRQRILARMGIPLWQQRGRLLAGGTSPDGAAQPANTPADEVLAPQETAPLPT
GKLWLLAETLPAPSLLGDICRWLGLGTDEVSLLSEMPSLPAGATSPLLWLTAPDSRWPDA
LVCPLKPDGAHKRALWQQCRQRHTP
NT seq 438 nt   +upstreamnt  +downstreamnt
atgcaagatcccctgctggacccgctgcgccagcgcatcctggcccgcatgggcatcccc
ctctggcaacagagaggccgactcctggcgggaggcaccagccccgacggcgccgcacaa
ccggcaaacacgcccgccgacgaggtgctggccccgcaggagactgcccctctgccgacc
ggcaagctctggctgctggcagagacgctgcccgcgccctccctgctcggggacatctgc
cgctggctcggccttggcaccgacgaggtctccctgttgtccgagatgccttccctgcca
gcaggggccacttcgcccctgctctggctgacggcgccggactctcgctggcccgatgcc
ctggtctgcccgctcaagcccgatggggcgcacaagcgcgccctctggcagcagtgccgg
cagcgccacaccccttga

KEGG   Aeromonas sp. ASNIH3: C2U39_18685
Entry
C2U39_18685       CDS       T05427                                 

Definition
(GenBank) 3'-5' exonuclease
  KO
K02342  DNA polymerase III subunit epsilon [EC:2.7.7.7]
Organism
aea  Aeromonas sp. ASNIH3
Pathway
aea03030  DNA replication
aea03430  Mismatch repair
aea03440  Homologous recombination
Brite
KEGG Orthology (KO) [BR:aea00001]
 09120 Genetic Information Processing
  09124 Replication and repair
   03030 DNA replication
    C2U39_18685
   03430 Mismatch repair
    C2U39_18685
   03440 Homologous recombination
    C2U39_18685
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03032 DNA replication proteins [BR:aea03032]
    C2U39_18685
   03400 DNA repair and recombination proteins [BR:aea03400]
    C2U39_18685
Enzymes [BR:aea01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.7  Nucleotidyltransferases
    2.7.7.7  DNA-directed DNA polymerase
     C2U39_18685
DNA replication proteins [BR:aea03032]
 Prokaryotic type
  DNA Replication Elongation Factors
   Elongation factors (bacterial)
    DNA polymerase III holoenzyme
     C2U39_18685
DNA repair and recombination proteins [BR:aea03400]
 Prokaryotic type
  SSBR (single strand breaks repair)
   MMR (mismatch excision repair)
    DNA polymerase III holoenzyme
     C2U39_18685
SSDB
Motif
Pfam: RNase_T DUF5051 RNase_H_2 DNA_pol_A_exo1
Other DBs
NCBI-ProteinID: AUV13991
UniProt: A0A2I8R6G1
LinkDB
Position
3989012..3989641
AA seq 209 aa
MSIASANTVVVLDFETTGLSPGQGDRAIEIGAVRIKDGHISERFSALMNPGFNVSSFIEQ
YTGISNAMLKQAPPCNEVMADFVDFIGDDNLVAHNASFDKRFLDAEIERLPAQYRGQFAC
SLLLSRRLFPDAPDHKLGTLVQYRSLPNDGVFHRALADAEVTAHLWLALLEELACRHGII
DPDFELLLTLGKKPKQVIPSFLREYATRK
NT seq 630 nt   +upstreamnt  +downstreamnt
atgtccatcgcctcagccaataccgttgtcgtgctcgacttcgagaccacagggctttca
cccggacaaggggatagagccatcgagatcggtgccgtcagaatcaaggatggccatatc
agtgagcgtttctcggcattgatgaatccgggcttcaacgtgagcagcttcatcgagcaa
tataccgggatcagcaatgccatgctgaaacaggctcccccctgtaacgaggtgatggcg
gatttcgtcgactttatcggtgatgacaatctggtcgcccacaacgcctccttcgacaag
cgctttctggatgcggaaatagagcgattgccggcgcaataccgcggccagttcgcctgt
tccctgctgctatcgaggcgcctgtttcccgatgccccggatcacaagctgggtaccctg
gtgcaataccggagcctgcccaatgacggggtatttcaccgtgccctggcggatgccgag
gtgacggcccacctctggcttgccttgttggaagagctggcgtgtcgacatggcattatc
gacccggactttgaattgctgctgacccttggcaagaagccaaaacaggtgattccatcc
ttcctgcgggaatatgcgactcggaaataa

KEGG   Aeromonas sp. ASNIH3: C2U39_19625
Entry
C2U39_19625       CDS       T05427                                 

Definition
(GenBank) DNA polymerase III subunit chi
  KO
K02339  DNA polymerase III subunit chi [EC:2.7.7.7]
Organism
aea  Aeromonas sp. ASNIH3
Pathway
aea03030  DNA replication
aea03430  Mismatch repair
aea03440  Homologous recombination
Brite
KEGG Orthology (KO) [BR:aea00001]
 09120 Genetic Information Processing
  09124 Replication and repair
   03030 DNA replication
    C2U39_19625
   03430 Mismatch repair
    C2U39_19625
   03440 Homologous recombination
    C2U39_19625
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03032 DNA replication proteins [BR:aea03032]
    C2U39_19625
   03400 DNA repair and recombination proteins [BR:aea03400]
    C2U39_19625
Enzymes [BR:aea01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.7  Nucleotidyltransferases
    2.7.7.7  DNA-directed DNA polymerase
     C2U39_19625
DNA replication proteins [BR:aea03032]
 Prokaryotic type
  DNA Replication Elongation Factors
   Elongation factors (bacterial)
    DNA polymerase III holoenzyme
     C2U39_19625
DNA repair and recombination proteins [BR:aea03400]
 Prokaryotic type
  SSBR (single strand breaks repair)
   MMR (mismatch excision repair)
    DNA polymerase III holoenzyme
     C2U39_19625
SSDB
Motif
Pfam: DNA_pol3_chi PP28
Other DBs
NCBI-ProteinID: AUV14155
UniProt: A0A2I8R7D7
LinkDB
Position
4182059..4182514
AA seq 151 aa
MSQVTFYLMSQPDDADASAVERLACQLAADGWSAGHLYLLCEDEAQALRLDELLWQLPPD
RFVPHQLQGESGQALVEIGHQPPRRRYACLINLARQTPLFAGHFAQVVDFVPTDETQKQQ
ARERYKHYRQAGHTLEMRDQPVLAAPDPAQP
NT seq 456 nt   +upstreamnt  +downstreamnt
atgagccaagtgaccttttacctgatgagccagcccgatgatgcggatgcctccgccgtc
gagcgcctcgcctgccaacttgcggccgatggctggagcgcaggccacctctatctgctg
tgcgaggacgaggcccaggccctgcgtctggacgagctgttgtggcagttgccgcccgat
cgcttcgtgccgcaccagttgcagggggagagcggtcaggctctggtggagataggccat
cagccgccacggcggcgctatgcctgcctcatcaacctggcccggcagacacctttgttt
gcaggacacttcgctcaagtggtagattttgtccccactgacgaaacgcaaaagcagcaa
gcccgcgagcgctacaagcactatcgccaggcgggccataccctcgagatgagggatcag
cccgtccttgccgcaccggatccggcgcagccctga

KEGG   Aeromonas sp. ASNIH3: C2U39_22235
Entry
C2U39_22235       CDS       T05427                                 

Definition
(GenBank) DNA polymerase III subunit beta
  KO
K02338  DNA polymerase III subunit beta [EC:2.7.7.7]
Organism
aea  Aeromonas sp. ASNIH3
Pathway
aea03030  DNA replication
aea03430  Mismatch repair
aea03440  Homologous recombination
Brite
KEGG Orthology (KO) [BR:aea00001]
 09120 Genetic Information Processing
  09124 Replication and repair
   03030 DNA replication
    C2U39_22235
   03430 Mismatch repair
    C2U39_22235
   03440 Homologous recombination
    C2U39_22235
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03032 DNA replication proteins [BR:aea03032]
    C2U39_22235
   03400 DNA repair and recombination proteins [BR:aea03400]
    C2U39_22235
Enzymes [BR:aea01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.7  Nucleotidyltransferases
    2.7.7.7  DNA-directed DNA polymerase
     C2U39_22235
DNA replication proteins [BR:aea03032]
 Prokaryotic type
  DNA Replication Elongation Factors
   Elongation factors (bacterial)
    DNA polymerase III holoenzyme
     C2U39_22235
DNA repair and recombination proteins [BR:aea03400]
 Prokaryotic type
  SSBR (single strand breaks repair)
   MMR (mismatch excision repair)
    DNA polymerase III holoenzyme
     C2U39_22235
SSDB
Motif
Pfam: DNA_pol3_beta DNA_pol3_beta_3 DNA_pol3_beta_2
Other DBs
NCBI-ProteinID: AUV14587
UniProt: A0A2I8R7X7
LinkDB
Position
4714501..4715604
AA seq 367 aa
MQLEISREALLRPLQLVSGALGGRPTLPILGNVLLDVSNGLLSLTGTDLEVEMIGQVYLN
SDSQDGRTTVPARKLLDICRGLPEGAEIRLSTEGERLIIRSGRSRFNLSTLPATEYPNIE
DWESVLEFDISQLELKKLIDATQFSMASQDVRYYLNGMLFESEGHGLRTVATDGHRLATC
RREVVGESLPDHQVILPRKGVLELVRLLEAEDKPVRLQVGRSNLRAALDGFIFTSKLVDG
RFPDWRRVIPRGSDKALIAGREDLRQAFARAAILSNEKFRGVRLNLQENLLRITANNPEQ
EEAEELLDVQYAAGEMEIGFNVSYVLDVLNTLKCDQIRISLSDSISSAIIEDFENQDAQY
VVMPMRI
NT seq 1104 nt   +upstreamnt  +downstreamnt
atgcagctcgaaattagccgtgaggccctgttacgtcccctgcaactggtgtccggtgcc
ctgggtggccggccgaccctgcccatcctcggcaacgtcctgctcgatgtcagcaatggc
ctgctgtcgctgaccgggaccgatctcgaggtggagatgatcggacaggtttatctcaac
agcgacagccaggatggccgcaccacagtgccggcgcgcaagctgctggacatctgtcgc
ggtctgccggagggggcggagatccgcctcagcaccgagggagagcgccttatcatccgg
tccggccgctcccgcttcaacctgtcgaccctgccggcgaccgaatacccgaacatcgag
gattgggaatccgtgctcgagttcgacatcagccagctggagctgaaaaaactcatcgac
gcgacccagttctccatggcgagccaggacgtgcgctactacctgaacggcatgctgttc
gagagcgaaggacacggcctgcgtaccgtggcgacggacggtcaccggctggccacctgc
cgccgcgaggtggtgggggaatcgttgcccgatcatcaggtcatcctgccgcgcaaaggg
gtgcttgagctggtgcgcctgctggaagcggaagacaagccggtacggctgcaagtgggt
cgcagcaacctgcgcgccgctctggatggcttcatcttcacctccaagctggtggatggc
cgtttcccggactggcgccgcgtcatcccgcgagggagcgacaaggccctgatcgccggt
cgcgaggatctgcgccaggcctttgcccgtgccgccatcctctccaacgagaaattccgt
ggggtgcgtctcaatctgcaggaaaacctgctgcgcatcaccgccaacaacccggaacag
gaagaagccgaagagctgcttgacgtacaatacgccgctggcgagatggagatcggcttc
aacgtctcctatgtgctggacgtgttgaatacgttaaaatgtgaccaaatccggatcagc
ctgagcgattccatcagcagcgccattattgaggattttgagaaccaagatgcccagtac
gtggtgatgccgatgcggatctag

KEGG   Aeromonas sp. ASNIH3: C2U39_22870
Entry
C2U39_22870       CDS       T05427                                 

Definition
(GenBank) 3'-5' exonuclease
  KO
K02342  DNA polymerase III subunit epsilon [EC:2.7.7.7]
Organism
aea  Aeromonas sp. ASNIH3
Pathway
aea03030  DNA replication
aea03430  Mismatch repair
aea03440  Homologous recombination
Brite
KEGG Orthology (KO) [BR:aea00001]
 09120 Genetic Information Processing
  09124 Replication and repair
   03030 DNA replication
    C2U39_22870
   03430 Mismatch repair
    C2U39_22870
   03440 Homologous recombination
    C2U39_22870
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03032 DNA replication proteins [BR:aea03032]
    C2U39_22870
   03400 DNA repair and recombination proteins [BR:aea03400]
    C2U39_22870
Enzymes [BR:aea01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.7  Nucleotidyltransferases
    2.7.7.7  DNA-directed DNA polymerase
     C2U39_22870
DNA replication proteins [BR:aea03032]
 Prokaryotic type
  DNA Replication Elongation Factors
   Elongation factors (bacterial)
    DNA polymerase III holoenzyme
     C2U39_22870
DNA repair and recombination proteins [BR:aea03400]
 Prokaryotic type
  SSBR (single strand breaks repair)
   MMR (mismatch excision repair)
    DNA polymerase III holoenzyme
     C2U39_22870
SSDB
Motif
Pfam: RNase_T DUF5051
Other DBs
NCBI-ProteinID: AUV14992
UniProt: A0A2I8R931
LinkDB
Position
pKPC-cd17:complement(22476..23303)
AA seq 275 aa
MPKTRKHLTPTEAEAKGLLCRKHLKERLRLMPGLNTKPAGSVWQGQGAYDVYNPAECVPW
RWMPGRAQVRRQHVAAQAKDLIAAGCIVLDTETTGLGDDAEICEITILDVTGAPILDTLV
RPTRPIPVEATAIHKITDAMVASAPSWPEVAEQYAAAVAGRTVVAYNVAFDARLLRQTYQ
IHGITAPVLTTACAMLMYAEWHGEYDRSRDRWRWLKLIEAATDCGVAEDGAHRALADARM
TLGVLRYLQRRTNGRRPAGPKVATVPQEALPSVLG
NT seq 828 nt   +upstreamnt  +downstreamnt
atgcccaaaacccgaaaacacctcaccccgaccgaagcagaggccaaggggcttctatgc
cgtaagcacctcaaggaacgcctccgcctcatgccgggactaaacaccaagcccgctggc
agtgtctggcaaggtcagggggcttatgatgtgtacaacccagccgagtgcgtgccgtgg
cgctggatgcctgggcgtgcccaagtccgtcgccagcacgtcgcagcgcaggcaaaagac
ctgatcgccgcaggctgcattgtgctcgacaccgaaaccaccggcctcggtgatgacgcc
gagatttgcgagataaccatactcgacgtgaccggcgcaccgatcctcgacacgctggta
cgcccgacccggccaatcccggtcgaggcgacagcgattcacaaaatcaccgacgccatg
gtggccagtgcgccgagctggcccgaggtggccgagcagtacgccgccgccgttgctggc
cgaaccgtcgttgcctacaacgtcgcttttgatgcgcgcttgctgcggcagacctatcag
atacacggaatcaccgcgccagtgttgacgaccgcttgcgcgatgctgatgtatgccgag
tggcatggagagtacgaccggagccgcgaccgctggcgatggttgaagctgatcgaggct
gcgaccgactgcggcgtggcagaagacggcgcacaccgcgcccttgccgacgcccgcatg
acgctgggtgtgctgcgatacttgcagcgccgcacgaacggacggcgaccggcagggccg
aaagtggccaccgtcccgcaggaggctttgccctctgttttaggatga

KEGG   Aeromonas sp. ASNIH3: C2U39_24010
Entry
C2U39_24010       CDS       T05427                                 

Definition
(GenBank) 3'-5' exonuclease
  KO
K02342  DNA polymerase III subunit epsilon [EC:2.7.7.7]
Organism
aea  Aeromonas sp. ASNIH3
Pathway
aea03030  DNA replication
aea03430  Mismatch repair
aea03440  Homologous recombination
Brite
KEGG Orthology (KO) [BR:aea00001]
 09120 Genetic Information Processing
  09124 Replication and repair
   03030 DNA replication
    C2U39_24010
   03430 Mismatch repair
    C2U39_24010
   03440 Homologous recombination
    C2U39_24010
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03032 DNA replication proteins [BR:aea03032]
    C2U39_24010
   03400 DNA repair and recombination proteins [BR:aea03400]
    C2U39_24010
Enzymes [BR:aea01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.7  Nucleotidyltransferases
    2.7.7.7  DNA-directed DNA polymerase
     C2U39_24010
DNA replication proteins [BR:aea03032]
 Prokaryotic type
  DNA Replication Elongation Factors
   Elongation factors (bacterial)
    DNA polymerase III holoenzyme
     C2U39_24010
DNA repair and recombination proteins [BR:aea03400]
 Prokaryotic type
  SSBR (single strand breaks repair)
   MMR (mismatch excision repair)
    DNA polymerase III holoenzyme
     C2U39_24010
SSDB
Motif
Pfam: RNase_T DNA_pol_A_exo1
Other DBs
NCBI-ProteinID: AUV15197
UniProt: A0A2I8R9N4
LinkDB
Position
pKPC-8e09:163615..164244
AA seq 209 aa
MNDEELELARAEAMKADRCFSKGRLRDEFRMKPKPGVEPVSFYKNGYGGQFGVYRIADCQ
PMRRRGCSPASQKQIRAQSILSVKARMRSNLAKASVMAQRWVALEPLVLDTETTGLGERD
QVIELAVTDIRGAVLLCTRLRPTVEIDPQAMGVHGITETELSNEPTWTQVAPALARLLSG
RHLVIFNSSFDSRMLAKFAQRAENVKLAL
NT seq 630 nt   +upstreamnt  +downstreamnt
atgaatgatgaagaactcgaacttgccagagccgaagccatgaaagccgataggtgcttt
tcaaaaggacggctcagggacgaatttcggatgaagcctaagccaggagtagagccagtt
tcgttctacaaaaacgggtatggtggccaatttggagtgtaccggatagcagattgccaa
ccaatgcggagaaggggttgttcaccggcatcacaaaagcaaataagggcgcaatccatc
ctttcggtcaaggcaagaatgcgtagcaacctggcaaaggcctctgtcatggcacaaagg
tgggtcgctctggaacctctggttctcgataccgagacgaccggacttggtgaaagagac
caggtgatcgagctggctgttactgacatcagaggcgcggttctcctctgcaccagatta
cggccaaccgtggaaatagaccctcaggcaatgggtgttcatggcatcaccgagactgag
ctgtcgaatgagcctacgtggactcaagttgcgccagctctcgcccggcttttgtcgggc
cgtcatctggtgatatttaactccagtttcgacagtaggatgttggctaaatttgcccaa
cgcgccgaaaatgtaaagttagctttataa

DBGET integrated database retrieval system