KEGG   Aeromonas sp. ASNIH3: C2U39_08325Help
Entry
C2U39_08325       CDS       T05427                                 

Gene name
alr
Definition
(GenBank) alanine racemase
  KO
K01775  alanine racemase [EC:5.1.1.1]
Organism
aea  Aeromonas sp. ASNIH3
Pathway
aea00473  D-Alanine metabolism
aea01100  Metabolic pathways
aea01502  Vancomycin resistance
Brite
KEGG Orthology (KO) [BR:aea00001]
 09100 Metabolism
  09106 Metabolism of other amino acids
   00473 D-Alanine metabolism
    C2U39_08325 (alr)
 09160 Human Diseases
  09175 Drug resistance: Antimicrobial
   01502 Vancomycin resistance
    C2U39_08325 (alr)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01011 Peptidoglycan biosynthesis and degradation proteins [BR:aea01011]
    C2U39_08325 (alr)
Enzymes [BR:aea01000]
 5. Isomerases
  5.1  Racemases and epimerases
   5.1.1  Acting on amino acids and derivatives
    5.1.1.1  alanine racemase
     C2U39_08325 (alr)
Peptidoglycan biosynthesis and degradation proteins [BR:aea01011]
 Precursor biosynthesis
  Racemase
   C2U39_08325 (alr)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Ala_racemase_N Ala_racemase_C
Motif
Other DBs
NCBI-ProteinID: AUV12185
UniProt: A0A2I8R1W3
LinkDB All DBs
Position
complement(1705273..1706499)
Genome map
AA seq 408 aa AA seqDB search
MHKKTLLATLIFGLLAGQAVAAPYLPLADDHRNGQEQTAANAWLEVDLGAFEHNIQTLKN
RLGDKGPQICAIMKADAYGHGIDLLVPSVVKAGIPCIGIASNEEARVAREKGFEGRLMRV
RAATPDEVEQALPYKLEELIGSLESAKGIADIAQRHDTNIPVHIGLNSAGMSRNGIDLRQ
DDAKADALAMLKLKGITPVGIMTHFPVEEKEDVKLGLAQFKLDYQWLIDAGKLDRSKLTI
HAANSFATLEVPEAYFDMVRPGGIIYGDTIPSYTEYKKVMAFKTQVASVNHYPAGNTVGY
DRTFTLKRDSLLANLPMGYSDGYRRAMSNKAYVLIHGQKAPVVGKTSMNTTMVDVTDIKG
IKPGDEVVLFGRQGDAEVKQSDLEEYNGALLADMYTVWGYTNPKKIKR
NT seq 1227 nt NT seq  +upstreamnt  +downstreamnt
atgcacaagaaaacactgctcgcgaccctgatctttggcctgctggccggccaggcggtc
gccgccccctatctgccgctcgccgacgaccaccgcaacggtcaggaacagaccgccgcc
aacgcctggctggaagtggatctcggtgccttcgagcacaacatccagaccctgaagaat
cgcctcggtgacaagggcccgcagatctgcgccatcatgaaggcggacgcctacggtcac
ggcatcgacctgctggtcccttccgtggtcaaggcaggcatcccttgcatcggcatcgcc
agcaacgaagaagcacgtgttgcccgcgagaagggcttcgaaggtcgcctgatgcgggtg
cgtgccgccaccccggatgaagtggagcaggccctgccctacaagctggaagagctcatc
ggcagcctggagagcgccaaggggatcgccgacatcgcccagcgccatgacaccaacatc
ccggtgcacatcggcctgaactccgccggcatgagccgcaacggcatcgatctgcgccag
gacgatgccaaggccgatgccctggccatgctcaagctcaaggggatcaccccggtcggc
atcatgacccacttcccggtggaggagaaagaggacgtcaagctggggctggcccagttc
aagctggactaccagtggctcatcgacgccggcaagctggatcgcagcaagctcaccatc
cacgccgccaactccttcgcaaccctggaagtgccggaagcctactttgacatggtgcgc
ccgggcggcatcatctatggcgacaccattccctcctacaccgagtacaagaaggtgatg
gcgttcaagacccaggtcgcctccgtcaaccactacccggcgggcaacaccgtcggctat
gaccgcaccttcaccctcaagcgcgactccctgcttgccaacctgccgatgggctactcc
gacggctaccgccgcgccatgagcaacaaggcctatgtgctgatccatggccagaaggcc
cccgtcgtgggcaagacctccatgaacaccaccatggtggacgtcaccgacatcaagggg
atcaaacccggtgacgaggtggtcctgttcggacgccagggtgatgccgaagtgaaacaa
tctgatctggaggagtacaacggtgccctcttggcggacatgtacaccgtctggggctac
accaaccccaagaagatcaagcgctaa

DBGET integrated database retrieval system