KEGG   Aeromonas sp. ASNIH3: C2U39_09025
Entry
C2U39_09025       CDS       T05427                                 

Definition
(GenBank) recombination protein RecR
  KO
K06187  recombination protein RecR
Organism
aea  Aeromonas sp. ASNIH3
Pathway
aea03440  Homologous recombination
Brite
KEGG Orthology (KO) [BR:aea00001]
 09120 Genetic Information Processing
  09124 Replication and repair
   03440 Homologous recombination
    C2U39_09025
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03400 DNA repair and recombination proteins [BR:aea03400]
    C2U39_09025
DNA repair and recombination proteins [BR:aea03400]
 Prokaryotic type
  DSBR (double strand breaks repair)
   HR (homologous recombination)
    RecFOR pathway proteins
     C2U39_09025
   NHEJ (non-homologous end-joining)
    SHDIR (short-homology-dependent illegitimate recombination)
     RecET pathway
      C2U39_09025
SSDB
Motif
Pfam: Toprim_4 RecR Toprim HHH_5 HHH Toprim_2 Laminin_EGF
Other DBs
NCBI-ProteinID: AUV12304
UniProt: A0A2I8R1T9
LinkDB
Position
1866073..1866675
AA seq 200 aa
MKFSPLLDEMMKALQVLPGVGPKSAQRMAFTLLERERSGGLRLASLLNRALTEIGHCSHC
RTFTENDRCDICANPKREENGLLCVVESPADVAAIEQTGQFSGRYFVLMGHLSPLDGIGP
EELGLDILERRLQEEQIKELILATNPTIEGDATAWYIADMARTAGVEVSRIAHGVPVGGE
LELVDGTTLSHSLMGRQRLS
NT seq 603 nt   +upstreamnt  +downstreamnt
atgaaattcagtcccctgctcgatgagatgatgaaggcgctgcaggtcttgccgggcgtg
ggcccgaaatcggcccagcgcatggcgttcaccctgctggagcgcgagcgcagcggcggt
ctgcgtctggcctccctgctcaaccgggcgctcaccgaaataggtcattgcagccactgc
cgcacctttaccgagaacgatcgctgcgatatttgcgccaatcccaagcgagaggagaac
ggcctgctctgcgtggtggagagtcccgcggacgtggccgccatcgagcagaccggccag
ttctccggccgttatttcgtgctgatgggccacctgtcgccccttgacggtatcggcccc
gaggagctggggctcgatatcctggagcgccgcctgcaagaggagcagatcaaggagctg
atcctcgccaccaaccccaccatcgagggggatgccaccgcctggtacatcgccgacatg
gcccgcaccgccggggtggaggtgagccgcatcgcccacggtgtgccggtgggcggggag
ctggagctggtggatggcaccacgctctcccactccctgatggggcgccagcgtctgagc
taa

DBGET integrated database retrieval system