KEGG   Aeromonas sp. ASNIH3: C2U39_11845Help
Entry
C2U39_11845       CDS       T05427                                 

Definition
(GenBank) D-alanine--D-alanine ligase
  KO
K01921  D-alanine-D-alanine ligase [EC:6.3.2.4]
Organism
aea  Aeromonas sp. ASNIH3
Pathway
aea00473  D-Alanine metabolism
aea00550  Peptidoglycan biosynthesis
aea01100  Metabolic pathways
aea01502  Vancomycin resistance
Brite
KEGG Orthology (KO) [BR:aea00001]
 09100 Metabolism
  09106 Metabolism of other amino acids
   00473 D-Alanine metabolism
    C2U39_11845
  09107 Glycan biosynthesis and metabolism
   00550 Peptidoglycan biosynthesis
    C2U39_11845
 09160 Human Diseases
  09175 Drug resistance: antimicrobial
   01502 Vancomycin resistance
    C2U39_11845
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01011 Peptidoglycan biosynthesis and degradation proteins [BR:aea01011]
    C2U39_11845
Enzymes [BR:aea01000]
 6. Ligases
  6.3  Forming carbon-nitrogen bonds
   6.3.2  Acid-D-amino-acid ligases (peptide synthases)
    6.3.2.4  D-alanine---D-alanine ligase
     C2U39_11845
Peptidoglycan biosynthesis and degradation proteins [BR:aea01011]
 Precursor biosynthesis
  Amino acid ligase
   C2U39_11845
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Dala_Dala_lig_C Dala_Dala_lig_N CPSase_L_D2 ATP-grasp ATPgrasp_ST
Motif
Other DBs
NCBI-ProteinID: AUV12795
UniProt: A0A2I8R3J5
LinkDB All DBs
Position
complement(2467696..2468685)
Genome map
AA seq 329 aa AA seqDB search
MKNMHVLLLCGGGGSEHEVSLRSANFLEKQLGLLPGIEVTRVEMFADRWLSADGRECKLG
LDKLLSFDSVARPVDYVVPCIHGYPGETGDLQSFLELAGLPYLGCDAEASKVCFNKITTK
LWLTAIGIPNTPYLFLTEQDEASLSEAKAALAKWGKVFIKAASQGSSVGCYSASNEADLV
KGIADAFGYSEQVLIEKAVKPRELEVAVYQYGDELVATYPGEICVPQDKFYTYEEKYSSA
SHTETALKAEGLTQAQADAIHEYALKAFRQLKLTHLSRIDFFLTEEGEILLNEINTFPGM
TSISMFPKLLEHHGHSFAHYLEQILRKAV
NT seq 990 nt NT seq  +upstreamnt  +downstreamnt
atgaagaacatgcatgtcttgctgctgtgcggcggtggcggctccgagcacgaagtctcg
ctgcgcagcgccaatttcctcgaaaaacagctcgggctcctgcccggtatcgaagtgacc
cgggtcgagatgtttgccgaccgctggctctccgccgacggtcgcgagtgcaagctgggg
ctggacaagctgctctcgttcgacagcgtggcccgtccggtggactacgtggtgccctgc
atccacggctatcccggtgagaccggcgatctgcaatccttcctcgagctggccggcctg
ccttatctgggttgtgacgccgaggcgagcaaggtgtgcttcaacaagatcaccaccaag
ctgtggctcaccgccatcggcatccccaataccccctacctgttcctgaccgagcaggac
gaggcgagcctgtccgaggcaaaagcggcgctggccaagtggggcaaggtcttcatcaag
gcggcctcccagggctcttccgtgggttgctactccgccagcaacgaggcagatctggtg
aagggcattgccgatgctttcggttactccgagcaggtattgatcgaaaaagcggtcaag
ccccgcgagctggaagtggcggtctaccagtatggtgacgagctggtggccacctatccg
ggggagatctgcgtaccccaggacaagttctacacctatgaagagaagtacagcagcgcc
agtcacaccgagaccgcgctcaaggccgaggggctgactcaggcccaggccgatgccatc
cacgagtacgccttgaaggcgttccgtcagctcaagctgacccacctgtcgcgcatcgac
ttcttcctgaccgaagagggggagattttgctcaacgagatcaacaccttcccgggcatg
acctccatctccatgttcccgaaactgctggagcaccacggccacagcttcgcgcactat
ctggagcagatcctgcgaaaggcggtctga

DBGET integrated database retrieval system