KEGG   Aeromonas sp. ASNIH3: C2U39_15305Help
Entry
C2U39_15305       CDS       T05427                                 

Definition
(GenBank) two-component system response regulator ArcA
  KO
K07773  two-component system, OmpR family, aerobic respiration control protein ArcA
Organism
aea  Aeromonas sp. ASNIH3
Pathway
aea02020  Two-component system
Brite
KEGG Orthology (KO) [BR:aea00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   02020 Two-component system
    C2U39_15305
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02022 Two-component system [BR:aea02022]
    C2U39_15305
Two-component system [BR:aea02022]
 OmpR family
  ArcB-ArcA (anoxic redox control)
   C2U39_15305
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Response_reg Trans_reg_C
Motif
Other DBs
NCBI-ProteinID: AUV13397
UniProt: A0A2I8R4H9
LinkDB All DBs
Position
3255909..3256628
Genome map
AA seq 239 aa AA seqDB search
MQTPHILIVEDELVTRNTLKSIFEAEGYIVLEANNGDEMHQALTSHTINLVIMDINLPGK
NGLLLARELREDDNIALMFLTGRDNEVDKILGLEIGADDYITKPFNPRELTIRARNLLSR
TMNVAAGGEEKKLVERYLFNGWALDINSRALVSPAGDMFKLPRSEFRAMLHFCENPGQIQ
TRAELLKKMTGRELKPHDRTVDVTIRRIRKHFESVGDTPEIIATIHGEGYRFCGELEQE
NT seq 720 nt NT seq  +upstreamnt  +downstreamnt
atgcaaacaccacatattctgatcgtcgaagacgagctggtcacccgcaacaccctcaag
agcatcttcgaagccgaaggctacatcgtgctggaagccaacaacggtgacgagatgcac
caggccctgaccagccacaccatcaacctggtgatcatggacatcaacctgccgggcaag
aacggcctgctgctggcgcgcgagctgcgtgaagatgacaacatcgccctgatgttcctg
accggtcgcgacaacgaagtggacaagatcctggggctggagatcggtgcagatgactac
atcaccaagccgttcaatccccgtgaactgaccatccgtgcccgcaacctgctgagccgc
accatgaacgtggccgccggtggcgaagagaagaagctggtggaacgttatctgttcaat
ggctgggccctggacatcaacagccgcgccctggtcagcccggctggcgacatgttcaag
ctgccccgctccgagttccgcgccatgctgcatttctgcgagaacccgggccagatccag
acccgtgccgagctgctcaagaagatgacgggccgcgaactcaagccccacgaccgcacc
gtggacgtgaccatccgccgtattcgcaagcacttcgagagcgtgggcgacaccccggag
atcatcgccaccatccatggcgaaggctatcgcttctgcggcgagctggagcaggagtaa

DBGET integrated database retrieval system