KEGG   Aeromonas sp. ASNIH3: C2U39_16005
Entry
C2U39_16005       CDS       T05427                                 

Definition
(GenBank) crossover junction endodeoxyribonuclease RuvC
  KO
K01159  crossover junction endodeoxyribonuclease RuvC [EC:3.1.22.4]
Organism
aea  Aeromonas sp. ASNIH3
Pathway
aea03440  Homologous recombination
Brite
KEGG Orthology (KO) [BR:aea00001]
 09120 Genetic Information Processing
  09124 Replication and repair
   03440 Homologous recombination
    C2U39_16005
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03400 DNA repair and recombination proteins [BR:aea03400]
    C2U39_16005
Enzymes [BR:aea01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.22  Endodeoxyribonucleases producing 3'-phosphomonoesters
    3.1.22.4  crossover junction endodeoxyribonuclease
     C2U39_16005
DNA repair and recombination proteins [BR:aea03400]
 Prokaryotic type
  DSBR (double strand breaks repair)
   HR (homologous recombination)
    RecBC pathway proteins
     C2U39_16005
    RecFOR pathway proteins
     C2U39_16005
SSDB
Motif
Pfam: RuvC DUF3882
Other DBs
NCBI-ProteinID: AUV14861
UniProt: A0A2I8R8Y2
LinkDB
Position
complement(3410590..3411111)
AA seq 173 aa
MSIILGIDPGSRITGYGVIRIVAGKAEYLGSGCIRTDLGELPSRLKQVYDGVSEIITQFK
PDEFAIERVFMARNADSALKLGQARGSAIVAAVNALLPVSEYSATQIKQAVVGTGGAAKE
QVQHMVTHLLKLSATPQADAADALGVALCHFHTRQSLIRMAGRASGSVRGRYR
NT seq 522 nt   +upstreamnt  +downstreamnt
atgagcatcattctggggatcgatcccggttcgcgcatcaccggttacggggtcattcgc
atcgtcgcgggcaaggcggaatacctgggatcgggctgcatccgcaccgatctgggggag
ctgccgtctcgcctgaagcaggtctatgacggggtgagcgagatcatcacccagttcaag
ccggacgagttcgccatcgagcgggtcttcatggcgcgcaacgcggactcggccctgaag
ctcggccaggccaggggaagtgccatcgtcgcggcggtcaatgccctgctgccggtgagc
gagtattcggccacccagatcaagcaggcggtggtgggcaccggtggcgctgccaaggag
caggtgcagcacatggtgactcatctgctcaagctctctgccaccccccaggcggatgcg
gcggatgccctcggggtggcgctctgccacttccacacccgtcagagcctcattcgcatg
gccgggcgggccagcggatcggtgcgcggccgttatcgctga

DBGET integrated database retrieval system