KEGG   Aeromonas sp. ASNIH3: C2U39_18665
Entry
C2U39_18665       CDS       T05427                                 

Definition
(GenBank) Holliday junction branch migration DNA helicase RuvB
  KO
K03551  holliday junction DNA helicase RuvB [EC:3.6.4.12]
Organism
aea  Aeromonas sp. ASNIH3
Pathway
aea03440  Homologous recombination
Brite
KEGG Orthology (KO) [BR:aea00001]
 09120 Genetic Information Processing
  09124 Replication and repair
   03440 Homologous recombination
    C2U39_18665
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03400 DNA repair and recombination proteins [BR:aea03400]
    C2U39_18665
Enzymes [BR:aea01000]
 3. Hydrolases
  3.6  Acting on acid anhydrides
   3.6.4  Acting on acid anhydrides to facilitate cellular and subcellular movement
    3.6.4.12  DNA helicase
     C2U39_18665
DNA repair and recombination proteins [BR:aea03400]
 Prokaryotic type
  DSBR (double strand breaks repair)
   HR (homologous recombination)
    RecBC pathway proteins
     C2U39_18665
    RecFOR pathway proteins
     C2U39_18665
SSDB
Motif
Pfam: RuvB_N AAA_lid_4 RuvB_C AAA AAA_5 AAA_22 Mg_chelatase AAA_3 AAA_16 Rad17 AAA_14 AAA_18 TIP49 NTPase_1 TniB Bac_DnaA RNA_helicase AAA_24 AAA_17 TsaE Sigma54_activ_2 NB-ARC HTH_15 AAA_28 IstB_IS21 ABC_tran
Other DBs
NCBI-ProteinID: AUV13987
UniProt: A0A2I8R677
LinkDB
Position
complement(3983079..3984089)
AA seq 336 aa
MIEADRLISAGAAREDEIIDRAIRPRKLADYTGQDHVCDQMEIFIEAARQRGEALDHLLI
FGPPGLGKTTLANIVANEMGVNIKTTSGPVLEKAGDLAALLTNLEPNDVLFIDEIHRLSP
VVEEVLYPAMEDYQLDIMIGEGPAARSIKLDLPPFTLIGATTRAGSLTSPLRDRFGIVQR
LEFYNVKDLTDIVSRSARCLGLDMTEDGALEVARRSRGTPRIANRLLRRVRDFAQVKSDG
RIDGPISARAMDMLDVDNEGFDFMDRKLLLAVIDKFMGGPVGLDNLAAAIGEEKDTIEDV
LEPYLIQQGYLQRTPRGRIATQRAYAHFGLERPADQ
NT seq 1011 nt   +upstreamnt  +downstreamnt
atgattgaagcggatcgcctcatctcggccggtgccgcccgtgaggacgagatcatcgat
cgggccatccggcccagaaagctggccgattacaccggacaggatcatgtctgcgatcag
atggagatcttcatcgaggccgcccgccagcgcggggaggccctcgatcatctgctgatc
ttcgggcctcccggccttggcaagaccacgctggccaacatcgtcgccaacgagatgggg
gtcaacatcaagaccacctcgggccccgtgctggagaaggccggcgatctggcggcgctc
ctcaccaacctggaaccgaacgatgtgctcttcatcgacgagatccaccgtctcagcccg
gtggtggaggaggtgctctacccggccatggaggattatcagctcgacatcatgataggg
gaggggccggcggcccgctccatcaagctcgatctccctcccttcaccctgatcggtgcc
accacccgggccggctccctcaccagccccctgcgtgaccggtttggcatcgtgcagcgc
ctcgagttttacaacgtcaaggacctgaccgacatcgtctctcgcagcgcccgttgcctc
gggctcgacatgacggaagacggcgctctcgaggtagcccgtcgctcccgggggacaccg
cggattgctaaccgtttgttaaggcgggtacgggattttgcccaggtgaagtctgacggg
cgaattgacggacccatttcggcccgtgccatggacatgctggacgtggacaacgaaggt
ttcgacttcatggatcgcaagctattgttggccgtcatcgacaagtttatgggggggccc
gtcgggctcgacaacctggccgccgccatcggtgaggagaaggacaccatagaagacgtg
ctggaaccttatctgatccagcaaggctatctgcaacgtacacccagagggcggatcgca
actcagagagcctacgcacactttggcctggaacgaccggcagatcagtag

DBGET integrated database retrieval system