KEGG   Aeromonas sp. ASNIH3: C2U39_18670
Entry
C2U39_18670       CDS       T05427                                 

Definition
(GenBank) Holliday junction branch migration protein RuvA
  KO
K03550  holliday junction DNA helicase RuvA [EC:3.6.4.12]
Organism
aea  Aeromonas sp. ASNIH3
Pathway
aea03440  Homologous recombination
Brite
KEGG Orthology (KO) [BR:aea00001]
 09120 Genetic Information Processing
  09124 Replication and repair
   03440 Homologous recombination
    C2U39_18670
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03400 DNA repair and recombination proteins [BR:aea03400]
    C2U39_18670
Enzymes [BR:aea01000]
 3. Hydrolases
  3.6  Acting on acid anhydrides
   3.6.4  Acting on acid anhydrides to facilitate cellular and subcellular movement
    3.6.4.12  DNA helicase
     C2U39_18670
DNA repair and recombination proteins [BR:aea03400]
 Prokaryotic type
  DSBR (double strand breaks repair)
   HR (homologous recombination)
    RecBC pathway proteins
     C2U39_18670
    RecFOR pathway proteins
     C2U39_18670
SSDB
Motif
Pfam: RuvA_N RuvA_C HHH_5 HHH IMS_HHH HHH_8 DUF3173 Cdd1
Other DBs
NCBI-ProteinID: AUV13988
UniProt: A0A2I8R663
LinkDB
Position
complement(3984098..3984712)
AA seq 204 aa
MIGRLRGVIIEKQPPEVLLEVGGVGYEVHMPMSCFYDLPELGKEAVIHTHFVVREDAQLL
YGFNHKQERALFRELIKTNGVGPKLALAILSGMTATQFVMSVEREEISSLVKLPGVGKKT
AERLVVEMKDRLKGWVSHDLFSPAEITLPAKESPLRAPDASEEAASALVALGYKPQQASQ
IVSKVAADGMSVEEIIRESLRSLV
NT seq 615 nt   +upstreamnt  +downstreamnt
atgatcggtcgcttgagaggcgtcatcatcgagaagcaaccccccgaggtgttgctggaa
gtcggaggggtgggatatgaggttcatatgcccatgagctgcttctatgatctgcccgaa
ctcgggaaagaggccgtcattcacacccacttcgtggtgcgtgaagatgcccagctgctc
tacggcttcaaccacaagcaggagcgggcgctgtttcgcgagctgatcaagaccaacggg
gtcggccccaagctggcactggccattctctccggcatgacggccacccagtttgtgatg
agcgtcgagcgcgaggagataagctccctggtcaagttgcccggcgtgggcaagaagacc
gccgagcgcctggtggtggagatgaaagaccgcctcaagggctgggtcagccacgatctc
ttctccccggccgaaatcaccctgcccgcgaaagagagcccgctgcgtgccccggatgcg
agcgaggaggcggccagtgcactggtggccctcggctacaagccgcagcaggccagccag
atcgtcagcaaggtggccgccgacggcatgtcggtagaggagatcattcgtgaatccctg
cgcagcctggtgtga

DBGET integrated database retrieval system