KEGG   Aeromonas sp. ASNIH3: C2U39_19700
Entry
C2U39_19700       CDS       T05427                                 

Gene name
recA
Definition
(GenBank) recombinase RecA
  KO
K03553  recombination protein RecA
Organism
aea  Aeromonas sp. ASNIH3
Pathway
aea03440  Homologous recombination
Brite
KEGG Orthology (KO) [BR:aea00001]
 09120 Genetic Information Processing
  09124 Replication and repair
   03440 Homologous recombination
    C2U39_19700 (recA)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03400 DNA repair and recombination proteins [BR:aea03400]
    C2U39_19700 (recA)
DNA repair and recombination proteins [BR:aea03400]
 Prokaryotic type
  DSBR (double strand breaks repair)
   HR (homologous recombination)
    RecBC pathway proteins
     C2U39_19700 (recA)
    RecFOR pathway proteins
     C2U39_19700 (recA)
  TLS (translesion DNA synthesis) factors
   Other SOS response factors
    C2U39_19700 (recA)
SSDB
Motif
Pfam: RecA Rad51 ATPase ATPase_2 AAA_24 AAA AAA_35 MobB AAA_25 AAA_14 TK AAA_16 CobU AAA_22 CLP1_P PAXNEB
Other DBs
NCBI-ProteinID: AUV14164
UniProt: A0A2I8R767
LinkDB
Position
complement(4194765..4195829)
AA seq 354 aa
MDQNKQKALAAALGQIEKQFGKGSIMRLGDSKTMDIEAISTGSLSLDVALGIGGLPCGRI
VEIYGPESSGKTTLTLQVIAEAQKKGKTCAFVDAEHALDPIYAAKLGVNVDDLLISQPDT
GEQALEICDMLVRSNAVDVIIVDSVAALTPKAEIEGEMGDSHVGLQARLMSQALRKLTAN
IKNANCLCIFINQIRMKIGVMFGSPETTTGGNALKFYASVRLDIRRTGAIKEGDEVVGNE
TRVKVVKNKVAPPFKQAEFQIFYGAGISKEGELVDLGVKHKLIDKAGAWYSYNGEKIGQG
KANVMKLFSENKALAAEVEVKLRELLLSGAAPVEEKATAAEYDEFEAENEQEFE
NT seq 1065 nt   +upstreamnt  +downstreamnt
atggatcagaacaaacagaaggcactggcggctgcgctgggccagatcgaaaagcagttt
ggcaaaggctccatcatgcgtctgggcgacagcaagaccatggatatcgaagccatctcc
accggctctctctctctggacgtggcgctggggatcggtggtctgccgtgcggtcgtatc
gtcgagatctacggtccggaatcgtccggtaaaactacgctgaccttgcaggtgatcgcc
gaagcccagaagaagggcaaaacctgtgccttcgtcgatgcggagcacgcactggatcct
atctatgccgccaagctgggcgtcaacgtcgacgacctgctcatctcccagccggatacc
ggtgaacaggcactggagatttgcgacatgctggtgcgctccaatgccgtcgacgtcatc
atcgtcgactccgtggcggccctgaccccgaaagcggaaatcgaaggcgaaatgggtgac
tcccacgtcggcctgcaggcccgactgatgtcccaggcgctgcgtaaattgaccgccaac
atcaagaacgccaactgcctgtgcatcttcatcaaccagatccggatgaagattggcgtc
atgttcggcagcccggagaccaccaccggtggtaacgctctgaagttttacgcctccgtg
cgcctggacatccgtcgtaccggcgccatcaaggaaggggacgaggtggtcggcaacgaa
acccgcgtcaaggtcgtcaagaacaaggtggcgccacccttcaagcaggctgagttccag
atcttctatggtgccggtatctccaaggagggcgagctggtggatctcggcgtcaagcac
aagctgatcgacaaggcgggcgcctggtacagctacaacggcgagaagatcggccagggc
aaagccaacgtgatgaagctcttctccgaaaacaaggcactggctgccgaggtggaagtg
aagctgcgcgagctgctgctctctggcgccgcgccggtggaagagaaggccacggctgcc
gaatacgacgagtttgaagctgaaaacgaacaagagttcgaataa

DBGET integrated database retrieval system