KEGG   Aeromonas sp. ASNIH3: C2U39_19955
Entry
C2U39_19955       CDS       T05427                                 

Gene name
recC
Definition
(GenBank) exodeoxyribonuclease V subunit gamma
  KO
K03583  exodeoxyribonuclease V gamma subunit [EC:3.1.11.5]
Organism
aea  Aeromonas sp. ASNIH3
Pathway
aea03440  Homologous recombination
Brite
KEGG Orthology (KO) [BR:aea00001]
 09120 Genetic Information Processing
  09124 Replication and repair
   03440 Homologous recombination
    C2U39_19955 (recC)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03400 DNA repair and recombination proteins [BR:aea03400]
    C2U39_19955 (recC)
Enzymes [BR:aea01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.11  Exodeoxyribonucleases producing 5'-phosphomonoesters
    3.1.11.5  exodeoxyribonuclease V
     C2U39_19955 (recC)
DNA repair and recombination proteins [BR:aea03400]
 Prokaryotic type
  DSBR (double strand breaks repair)
   HR (homologous recombination)
    RecBC pathway proteins
     C2U39_19955 (recC)
SSDB
Motif
Pfam: Exonuc_V_gamma RecC_C
Other DBs
NCBI-ProteinID: AUV14206
UniProt: A0A2I8R6Z5
LinkDB
Position
complement(4242263..4245619)
AA seq 1118 aa
MFTLYHSNQLDLLKELLVSRIRQAPLSHPFDREQILVQSPGMAQWLKLELAKAFGIAANI
DFPLPASFIWEMFTRVLADVPRQSPYNKGAMSWHLMTILPTLLGRPAFAPLAAYLGGSDG
AAPEQVRLWQLCQKVADLFDQYLVYRPDWIARWEEGEGLSQELAGVSGQDWQPELWRELV
ARTLALSPSGYHRANLYEAFIHELERTRDLPGRLPQRVFVFGISALPPRYVEALLALGSR
PEVEVHLFVTNPCRYYWGDLLDRKTLARLENKLKPGTDLETLQGPANPLLASMGKLGRDY
LHQLMELEVPQIEAFVDIEDRDDEGKVTLLRAIQKDVLELAERGAGEFNLDASHHKSPVS
LDDGTLQIHACHGPMRELEVLHDRLLALFEQDPTLTPKDVVVMMPDVNSYGPYIQAVFGK
EGGKGRGGARGQIPFAISDRAASQESPLLQSFLALLRLPNARFGAGELLAILEVPAVLRR
FELDDDEFNVLRRWVQETGIRWGLDDDYPERFALPRLSGNSWLFGLRRMLLGFAMGDGEP
VAGILPYADIEGQQGLILGKLAWFIDSLAEFLPRLQQAQPLAEWHACLLALLERFYLADE
DEERQLQLIRSQLTDWQAQLGEARFEQAISADLLQDYLGSVLGESRSSQRFLAGQVNFCT
LMPMRSIPFRQVCLLGMNDGVYPRTLPPMGFDLMAVASRRGDRSRRDDDRYLFLEALLSA
QQGLYISYQGFSAQDNSEKVPSVLLAELIDYARQGFVLAGDEDLDDDTSGRRLLEHLIVA
HPLTPYSPAYFYPEPGSGLFTYAADWLPALSPERGAANFQSGDLPLPAEWGREQGLELAE
LLRFYRQPARYFLNRRLKVWFELEEATIEDSEPFELDGLQHYQLKALLLEAHLTEGESEA
RRHRLQLSGLLPQGWFGSLLLEEIDGEMGKLAARLRPWTGDKQAVEIDIALAQGQLQGWI
DTQKGRALVVKPGSFNGKDLLLAWIQHLCLSLSSAPGDTLLFDAKQSLRLPRLAADEARP
RLAALVALWTQGMKRPLPFFPSTAWEWFKAIEKDPAKPEEADKAALARFNGGYMVTGEGQ
DVYVARCFPELDDEVLAQLQGLAREHLTPLHQALEELQ
NT seq 3357 nt   +upstreamnt  +downstreamnt
atgtttaccctctaccactccaatcagctggatctgctcaaggagctgctggtgagccgc
atccggcaggctccgctctcccaccccttcgatcgggagcagatcctggtgcagagtccc
ggcatggcccagtggctcaagctggagctggccaaggcgttcggcatcgccgccaacatc
gactttcccctgcccgcgagtttcatctgggagatgttcacccgggtgctggcggacgtg
ccccgccagagcccctacaacaagggggccatgagctggcacctgatgaccattctgccc
actctgctcggcagacccgcctttgcgcccctcgcggcctatctggggggcagtgacggg
gcggcgccggagcaggtgcggctctggcagctctgccagaaggtggcggatctgttcgac
cagtatctggtctaccggccggactggatcgctcgctgggaagagggggaaggattgagc
caggagctggccggagtgagcggtcaggattggcagcccgagctctggcgcgagctggtg
gcccgcaccctggccctcagccccagcggctaccaccgcgccaacctctacgaggccttc
atccacgagctggagcgcacccgggatctgccgggcaggctgccgcaacgggtcttcgtg
ttcggcatctcggccctgccgccccgctatgtggaggccctgctggccctcggcagccgc
cccgaggtggaggtgcacctgtttgtgaccaacccctgccgctactactggggggacttg
ctcgatcgcaagaccctggcgcgcctcgaaaacaagctcaagcccggcacggatctcgag
accctgcagggtcccgccaaccccttgctcgcctccatgggcaagctggggcgcgactac
ctgcaccagctgatggagctggaggtgccgcagatcgaggccttcgtcgacatcgaggat
cgcgacgatgagggcaaggtcaccttgctgcgggccatccagaaagacgtgctggagctg
gcggaacggggggccggcgagttcaatctcgatgccagccaccacaagagccctgtcagc
ctggatgacggcactttgcagatccacgcctgccacggccccatgcgggagctcgaggtg
ctgcacgaccggctgctggccctgttcgagcaggatcccaccctcacccccaaagacgtg
gtggtgatgatgccggacgtcaacagctacggcccctacatccaggccgtctttggcaag
gagggcggcaaggggcggggcggggcccgcggccagatcccctttgcgatctccgatcgg
gcggcgagccaggagagcccgctgctgcaaagtttcctcgccctgctcaggctgccgaac
gcccgcttcggggcgggggagctgctcgccatcctggaggtgcccgccgtgctgcgccgc
ttcgagctggacgacgacgagttcaacgtgctgcggcgctgggtccaggagaccggcatc
cgctgggggctggatgacgactatcccgagcgcttcgcgctgccgcgtctgtccggcaac
agctggctgttcggcctgaggcgcatgctgctgggctttgccatgggggacggggagccg
gtggcggggatcctgccctatgcggacatcgaggggcagcaggggctgatcctcggcaag
ctcgcctggtttatcgattcgctcgcggaatttctgccccggctgcaacaggcgcagccg
ctggccgaatggcacgcctgcctgctggcgctgctggagcgcttctatcttgccgacgag
gatgaagagcgccagctccagctcatccgcagccagctcaccgactggcaggcccagctc
ggcgaggcccgcttcgagcaggccatcagtgccgacctgttgcaggactacctcggcagc
gtgctgggggagtcccgctccagccagcgcttcctcgccggtcaggtcaacttctgcacc
ctgatgccgatgcgctccatccccttccgccaggtctgcctgctcggtatgaacgacggc
gtctacccgcgcaccctgccccccatgggcttcgatctgatggcggtggcctcgcggcgc
ggggaccgatcccgccgggatgacgaccgctacctcttcctcgaggcgctcctcagtgcc
cagcaggggctctacatcagctatcaggggttcagcgcccaggacaacagcgagaaggtg
ccctccgtgctgctggcggagctcatcgactacgcgcgccagggcttcgtgctggcgggg
gatgaagatctcgacgacgacacctcgggccggcggctgctcgaacacctgatcgtggcg
caccccctcaccccctacagcccggcctacttttaccccgaacccggctccggtctcttc
acctatgccgccgactggctgccggcactgagcccggagcggggtgccgccaacttccag
agcggcgatctgcccctgcccgcggagtggggcagggagcaggggctggagctggcggag
ctgctgcgcttctatcgccagcccgccaggtacttcctcaaccgccgcctcaaggtgtgg
ttcgagctggaggaggcgaccatcgaagacagcgagcccttcgagctggacggcctgcag
cactatcagctcaaggcgctgctgctggaagctcatctgaccgaaggggagagcgaggcc
cgtcgccaccggctgcaactctccggcctgctgccgcaagggtggtttggcagcctgctg
ctggaggagatcgacggcgagatgggcaagctggcggcgcggctgcgcccctggacgggg
gacaaacaggcggtggagatcgacatcgccctggcccaggggcagcttcagggctggata
gacacccagaagggacgagcgctggtggtcaaacccggcagcttcaacggcaaggatctg
ctgctggcctggatccagcacctttgcctctcattgagcagcgcccccggcgacaccctg
ctgttcgatgccaaacagagtctgcggctgccgaggcttgcggcggacgaggcgcggccc
aggttggcggccctggtggccctctggacccaggggatgaagcggccgctgcccttcttc
ccgagcaccgcctgggagtggttcaaggcgatcgagaaggatccggcaaagccggaggag
gccgacaaggcggcacttgcccgcttcaacggcggctacatggtgacgggagaggggcag
gacgtctatgtcgcccgctgcttcccggaactcgatgacgaggtgctggcccagttgcag
gggttggcccgtgaacacctgaccccgctccatcaggcgctggaggagttgcaataa

DBGET integrated database retrieval system