KEGG   Aeromonas sp. ASNIH3: C2U39_20880
Entry
C2U39_20880       CDS       T05427                                 

Definition
(GenBank) primosomal protein N'
  KO
K04066  primosomal protein N' (replication factor Y) (superfamily II helicase) [EC:3.6.4.-]
Organism
aea  Aeromonas sp. ASNIH3
Pathway
aea03440  Homologous recombination
Brite
KEGG Orthology (KO) [BR:aea00001]
 09120 Genetic Information Processing
  09124 Replication and repair
   03440 Homologous recombination
    C2U39_20880
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03400 DNA repair and recombination proteins [BR:aea03400]
    C2U39_20880
Enzymes [BR:aea01000]
 3. Hydrolases
  3.6  Acting on acid anhydrides
   3.6.4  Acting on acid anhydrides to facilitate cellular and subcellular movement
    3.6.4.-  
     C2U39_20880
DNA repair and recombination proteins [BR:aea03400]
 Prokaryotic type
  DSBR (double strand breaks repair)
   HR (homologous recombination)
    RecBC pathway proteins
     C2U39_20880
SSDB
Motif
Pfam: PriA_3primeBD PriA_C DEAD Helicase_C ResIII PriA_CRR zinc-ribbons_6 AAA_30 PIF1 TrwB_AAD_bind
Other DBs
NCBI-ProteinID: AUV14369
UniProt: A0A2I8R9G0
LinkDB
Position
4440885..4443092
AA seq 735 aa
MNSSQTLDLVRVAVPVPLRRHFDYLSPLPLPAPGCRVEIPFGPQTLVGLVVDHPTESQVP
RNKLKPLKRVLDSAPVLGPDILALMAWSAGYYQHPLGEVLPHALPVLVRKGEPAAYRELE
FWFATEAGMAIDLNELKRAAKQQQALALLRKGPQTPSALKQEEIQSAALTALEKKGLLEK
RSLEPSHDGDWATRFEPGEGLRLNGEQALAVAAVTSQSNKFGAFLLDGITGSGKTEVYLS
ILEPLLKAGKQALVMVPEIGLTPQTINRFRRRFNVPVVAMNSAMNDRERLDAWLACRDGG
AAILIGTRSAVFTPFKDLGIIIIDEEHDGSFKQQDGFRYHARDLAVMRAHRAGIPILLGS
ATPSLETLHNARSGKYHHLTLTRRAGNAQTARQVILDIKNVRLQAGLSPQLEQLMAEHLA
AGNQVMLFLNRRGYAPALICHQCGWSAACERCDAWYTWHQAGRRLHCHHCDSVRPLPHHC
PECGSSELIGSGVGTEQLEQLLGTVFPQYPVVRIDRDNTRRKGELETHLGDIKAGKYKIL
IGTQMLAKGHHFPDVTLVGLLDVDGALFSADFRAAEKLAQLYTQVAGRAGRASKPGLVVL
QSHHPEHALLQDLTQNGYGHFADTALKERRLLGLPPFSHQGLFRAEANGRDEVQLFLSRL
ADTLRSARYPQVQVLGPISGFMERKAGKFRMQLLVQGPSRAPLAQLLDWAVKELEGWPET
KRVRWSLDIDPTELN
NT seq 2208 nt   +upstreamnt  +downstreamnt
gtgaattcttcccaaacgctggatctggttcgtgtggctgtgccggtgccgttacgccgt
catttcgactatctctctcccctgcccttgcctgcccccggttgccgggtcgagatcccg
ttcggcccgcagaccctggtcggtctggtggtggatcacccgaccgagagccaggtcccc
cgcaacaaattaaagcccttgaagagggtgctcgacagcgcccccgtgctggggcccgac
atcctggcgctgatggcctggagcgccggttactaccagcacccgctgggggaggtactg
ccccacgccctgccggtgctggtgcgcaagggggagcccgccgcctatcgggagctggag
ttctggtttgccaccgaggccggcatggccatcgacctcaacgagctcaagcgggcggcc
aagcagcagcaggccctcgccctgctgcgcaaggggccgcagaccccctccgccctcaaa
caggaggagatccagagcgcagccctcaccgcgctggagaagaagggactgctggagaag
cgctcgctggagccgagccatgatggcgactgggccactcgcttcgagccgggtgagggg
ctgcgcctcaacggcgagcaggcgctggcggtggccgccgtcaccagccagagcaacaag
ttcggagccttcctgctggacggcatcacgggctccggcaagaccgaggtttacctcagc
atcctcgagcccctgctcaaggcgggcaagcaggcgctggtgatggtgccggaaatcggc
ctcaccccccagaccatcaaccgcttccggcgccgcttcaacgtgcccgtggtggcgatg
aactccgccatgaacgacagggagcggctcgatgcctggctcgcctgccgcgacggtggt
gccgccattctgatcggcacccgatccgcggtgttcacgccgttcaaggacctcggcatc
atcatcatcgacgaggagcacgacggctccttcaagcaacaggacggctttcgctaccac
gcccgggatctggcggtgatgcgggcccatcgcgccggcattcccatcctgcttggatct
gccaccccgtcgctggagacgctgcacaatgcccgcagcggcaagtatcaccacctcact
ctcactcgccgcgccggcaacgcccagaccgctcgccaggtgatcctggatatcaagaac
gtgcggctacaggccgggctctccccccagctggaacagctgatggcagagcatctggcg
gcgggcaaccaggtaatgctgtttctcaaccgccggggctatgccccggctcttatctgc
caccagtgcggctggagtgccgcctgcgagcgctgcgacgcctggtacacctggcatcag
gccgggcgacggctgcactgccaccactgcgacagcgtgcgcccgttgccccaccactgt
cccgagtgtggcagcagcgagctcatcggctccggggtcggcaccgaacagctggagcaa
ctgctcggcaccgtgttcccgcaatatccggtggtgcgcatcgaccgggacaacacccgc
cgcaagggggagctggagacgcacctcggcgacatcaaggcgggcaagtacaagatcctg
atcggcacccagatgctggccaagggccaccacttcccggatgtgaccctggtagggctg
ctggatgtggatggcgccctgttcagcgccgattttcgcgccgccgagaagctggcccag
ctctacacccaggtggcgggccgggctggtcgcgccagcaaaccggggctggtggtgctg
cagagccaccatcccgaacacgccctgctgcaggatctgacccagaacggctatggccac
ttcgccgacacggcgctgaaagagcgccgcctgctggggctgccaccgttcagccatcag
gggctgtttcgggccgaggccaacggccgcgacgaggtacagctgttcctcagtcgtctc
gccgataccctgcgcagcgcccgctatccccaggtgcaggtgctcgggcccatcagcggc
ttcatggagcgcaaggcgggcaagtttcgcatgcagctgctggtgcaggggcccagccgg
gcaccactggcccagctgctcgactgggcggtgaaggagctggaggggtggcccgagacc
aagcgggtgcgctggagcctggatatcgaccccacggaactgaactag

DBGET integrated database retrieval system