KEGG   Aeromicrobium sp. A1-2: C6I20_02730Help
Entry
C6I20_02730       CDS       T05642                                 

Definition
(GenBank) crotonase/enoyl-CoA hydratase family protein
  KO
K01692  enoyl-CoA hydratase [EC:4.2.1.17]
Organism
aeb  Aeromicrobium sp. A1-2
Pathway
aeb00071  Fatty acid degradation
aeb00280  Valine, leucine and isoleucine degradation
aeb00281  Geraniol degradation
aeb00310  Lysine degradation
aeb00360  Phenylalanine metabolism
aeb00362  Benzoate degradation
aeb00380  Tryptophan metabolism
aeb00410  beta-Alanine metabolism
aeb00627  Aminobenzoate degradation
aeb00640  Propanoate metabolism
aeb00650  Butanoate metabolism
aeb00903  Limonene and pinene degradation
aeb00930  Caprolactam degradation
aeb01100  Metabolic pathways
aeb01110  Biosynthesis of secondary metabolites
aeb01120  Microbial metabolism in diverse environments
aeb01130  Biosynthesis of antibiotics
aeb01212  Fatty acid metabolism
Brite
KEGG Orthology (KO) [BR:aeb00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00640 Propanoate metabolism
    C6I20_02730
   00650 Butanoate metabolism
    C6I20_02730
  09103 Lipid metabolism
   00071 Fatty acid degradation
    C6I20_02730
  09105 Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    C6I20_02730
   00310 Lysine degradation
    C6I20_02730
   00360 Phenylalanine metabolism
    C6I20_02730
   00380 Tryptophan metabolism
    C6I20_02730
  09106 Metabolism of other amino acids
   00410 beta-Alanine metabolism
    C6I20_02730
  09109 Metabolism of terpenoids and polyketides
   00903 Limonene and pinene degradation
    C6I20_02730
   00281 Geraniol degradation
    C6I20_02730
  09111 Xenobiotics biodegradation and metabolism
   00362 Benzoate degradation
    C6I20_02730
   00627 Aminobenzoate degradation
    C6I20_02730
   00930 Caprolactam degradation
    C6I20_02730
Enzymes [BR:aeb01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.17  enoyl-CoA hydratase
     C6I20_02730
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ECH_1 ECH_2 Peptidase_S49
Motif
Other DBs
NCBI-ProteinID: AXT84213
UniProt: A0A3B7D559
LinkDB All DBs
Position
complement(555562..556326)
Genome map
AA seq 254 aa AA seqDB search
MTIHVEKRSPVTVVTLERPEVRNAVDTPHASALYEAFLEFDTDDTASVAVLTGAGGYFCA
GADLKAVSTGTMTAEPPTVEGPGPMGPTRMKLSKPVIAAVDGHAVAGGLELALWCDLRVA
DPEAVFGVYCRRWGVPLIDGGTVRLPRLIGLSRALDLILSGRPVDAAEALQIGLANRVSA
PGEALAEAITLAEQLAAFPQICMRGDRLSAYEQCGLTETDAIGAEWEHGTRALQEAIAGA
TNFAQGQGRHGAFN
NT seq 765 nt NT seq  +upstreamnt  +downstreamnt
gtgaccatccacgtcgagaaacgcagccccgtcacggtggtgactctcgagcgtcccgag
gtgcgcaacgccgtcgacaccccgcatgcctcggcgctctacgaagcctttctcgagttc
gacacagatgacacggccagcgtcgcggtgctcactggcgccggtggatacttctgcgcc
ggtgccgacttgaaggccgtcagcaccggcaccatgaccgccgagccgcccacggtggag
ggtcctggtccgatgggccccacccggatgaagctttccaaaccggtcatcgccgcggtt
gacggtcacgccgttgccggcggactggagctcgcattgtggtgcgacttgcgagtggca
gaccctgaagccgtgttcggtgtctactgccgccgctggggcgttcccctcatcgacgga
gggaccgttcggctgcccagactcatcggactctcgcgcgcgcttgatctcatcctcagc
ggtcgaccagtcgacgctgcggaggcactccagattggcctggccaaccgcgtcagcgca
ccgggcgaggctctcgcggaggccatcacactggccgagcagctggctgcattcccacag
atctgcatgcgcggtgaccgactctccgcctacgaacaatgcggactcaccgagaccgac
gccatcggagccgagtgggagcacggcacgcgcgccctccaggaagccatagccggcgcc
accaatttcgcccaaggacaaggccgacacggcgccttcaactga

DBGET integrated database retrieval system