KEGG   Aeromicrobium sp. A1-2: C6I20_03780Help
Entry
C6I20_03780       CDS       T05642                                 

Definition
(GenBank) glycerol-3-phosphate dehydrogenase
  KO
K00111  glycerol-3-phosphate dehydrogenase [EC:1.1.5.3]
Organism
aeb  Aeromicrobium sp. A1-2
Pathway
aeb00564  Glycerophospholipid metabolism
aeb01110  Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:aeb00001]
 09100 Metabolism
  09103 Lipid metabolism
   00564 Glycerophospholipid metabolism
    C6I20_03780
Enzymes [BR:aeb01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.5  With a quinone or similar compound as acceptor
    1.1.5.3  glycerol-3-phosphate dehydrogenase
     C6I20_03780
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: DAO DAO_C FAD_binding_2 FAD_binding_3 FAD_oxidored Pyr_redox_2 Pyr_redox 3HCDH_N GIDA AlaDh_PNT_C NAD_binding_8
Motif
Other DBs
NCBI-ProteinID: AXT84401
UniProt: A0A3B7D3L3
LinkDB All DBs
Position
768754..770499
Genome map
AA seq 581 aa AA seqDB search
MRSVALSPENRQAALDAMAQTPLDVLVIGGGVVGAGSALDAATRGLSVGLVEARDFASGT
SSRSSKLMHGGLRYLEMLDFRLVAEALRERGLNLRKLAPHLVHEVGFLYPLTHRVWERFY
AGSGVALYDAMSKASGYGQGVPLHRHLTRRGARRMMPALKKDALVGALHYYDAQVDDARH
TMFLSRTAAAYGAHVASRTRVVGLLREGDRVTGAKVKDLESGREFDIRARQVINSTGVWT
DETQGMTSERGQFHVRASKGVHLVVPRDRIRGESGLILRTEKSVLFVIPWGRHWIIGTTD
TDWSLSKDHPAASRSDIDYLLDHVNTVLIDPLTHEDVEGVYAGLRPLLAGEDEATSKLSR
EHAVGTSVKGLVVIAGGKYTTYRVMAKDAVDAAVHGMSTHLGRTVPPSCTEDVPLLGADG
YEAVWNQRQMLAESSGLGVGRIEHLLHRYGSLTQELLDLIAERPDLGNALSGADDYLRAE
ITYAASHEGARHLDDAIARRTRISIETFDRGTDVAEEVAGLMGGVLGWSEAQRANEVDHY
LKRVEAERESQTMPDDETADAARKGAVDVVPVSTLSAQTAP
NT seq 1746 nt NT seq  +upstreamnt  +downstreamnt
atgagatcggtagccctgtcacccgaaaaccgtcaagccgctctcgatgcgatggcacag
acgccgttggacgtgctggtcatcggcggaggagttgtgggcgcaggctccgcgctcgat
gcggcgacccgcggactgtctgtgggcctggtcgaggcgcgcgacttcgcgtccggtacg
tcgagccgttccagcaagctcatgcacggtggcctgcgctacctggagatgctggatttc
cggctcgtcgccgaggcgctcagggagcgcggactgaacctgcgcaagctggcaccccac
ctcgtgcacgaagtcggtttcctctatccgctgacgcaccgcgtgtgggagcgcttctac
gccggctccggcgtcgcgctgtacgacgcgatgagcaaggcttccggatacggccagggc
gtaccgctgcaccgtcacctgacccggcgtggggcgcgtcggatgatgccggcgctcaag
aaggacgcactggtcggcgcgctgcactactacgacgcgcaggtcgacgatgcccggcac
acgatgttcctgtcgcgcaccgccgcggcgtatggagcccacgtcgccagccgcacacgt
gtcgtgggcctgctccgcgagggcgaccgagtcacgggggccaaggtcaaggacctggag
tccggccgcgagttcgacatccgggcaaggcaggtcatcaactcgacaggagtctggacc
gacgagacgcagggcatgacctccgagcgcgggcagttccacgtccgcgcgagcaagggc
gtgcacctcgtggtgccgcgcgaccgcatccgcggggagtccggcctgatcctgcgcacc
gagaagtcggtgctgttcgtgatcccgtgggggcgtcactggatcatcggcacgaccgac
accgactggtcgctctccaaggaccaccccgcggccagtcgcagcgacatcgactacctg
ctcgaccacgtcaacacggtgcttatcgatcccctgacccacgaggatgtcgaaggcgtc
tacgccggcctgcggccgttgctcgccggcgaggacgaggcgaccagcaagctctcacgc
gagcacgcggtcggcacgagcgtcaaggggctcgtcgtgatcgcgggcggcaagtacacg
acgtaccgggtcatggccaaggacgccgtcgacgctgcggtgcacgggatgtcgacgcac
ctgggccgcacggtccctccctcgtgcaccgaggacgtccccctgctgggtgccgacggc
tacgaggcggtctggaaccagcggcagatgctggccgagtccagtggtctgggcgtgggt
cggatcgagcacctgttgcaccggtacggctcgctgacccaggagctgctcgacctgatc
gccgagcggccggatctgggcaatgcgctctccggcgcggacgactacctgcgcgccgag
atcacctacgccgcgtcgcacgagggtgccaggcacctggacgacgcgatcgcgcgacgc
acgcgcatctcgatcgagaccttcgatcgcggcaccgacgtcgccgaggaggtcgccggg
ctgatgggtggcgtgctcggctggagcgaggcccagcgggccaacgaggtcgaccactac
ctcaagcgggtcgaggccgaacgggagagccagacgatgcctgacgacgagaccgccgac
gcggcccgcaagggcgccgtcgacgtcgtcccggtctcgaccctgtcggcgcagactgcc
ccatga

DBGET integrated database retrieval system