KEGG   Aeromicrobium sp. A1-2: C6I20_06475Help
Entry
C6I20_06475       CDS       T05642                                 

Definition
(GenBank) ATP-dependent DNA ligase
Organism
aeb  Aeromicrobium sp. A1-2
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: DNA_ligase_A_M DNA_ligase_A_C RNA_ligase
Motif
Other DBs
NCBI-ProteinID: AXT84871
UniProt: A0A3B7D4X1
LinkDB All DBs
Position
1336840..1337925
Genome map
AA seq 361 aa AA seqDB search
MDLPVMPPLRPMLAKSVKGVPAADSVEGGLSYEPKWDGFRCIVFRDGDEIELASRSAKSL
TRYFPEIVEAIRAETPPRCVLDGEIFLAIDGRLDFDALSQRIHPAASRVTMLSVETPASF
VAFDLLALGDESYVDAPFSQRRAALERALASAADPIHVTRTTTDASLAEEWFGIFEGAGL
DGVVAKPLARAYVPNGRTMLKIKHSRTADVVVAGYRLHKTSTDERPLLGSLLLGLYADDG
QLQHVGVAASFTEARRAELIAELAPLVVEASDHPWGRWQEAQAQAGSRLPGGQSRWTGTK
DLSFVTLAPTRVAEVGYEHMEGDRFRHTAQFKRWRDDREPESCTYEQLEEVAKYDLGQVL
T
NT seq 1086 nt NT seq  +upstreamnt  +downstreamnt
atggatctgcccgtcatgcccccgctgcgacccatgctggcgaagtcggtcaagggcgtg
cccgccgccgactccgtcgaaggggggctctcctacgaaccgaaatgggacggcttccgc
tgcatcgtgttccgagacggcgacgagatcgagctcgcgagccggtcggccaagtcgctg
acgcgctacttccccgagatcgtcgaggccatccgcgccgagacgccgccgcggtgcgtg
ctggacggcgagatcttcctggcgatcgacgggcggctcgacttcgacgcgctctcccag
cgcattcacccggcagcgtcccgtgtcacgatgctgtcggtcgagacgccggcctcgttc
gtcgcgttcgacctgctggccctgggcgacgagtcctacgtcgatgcaccgttctcccag
cgacgtgcggcgttggagcgggccctggcgtcggccgccgacccgatacacgtcacccgc
acgacgaccgatgcgagcctcgcggaggagtggttcgggatcttcgagggcgccgggctc
gacggcgtcgtcgccaagccgctcgcccgggcctacgtgcccaacggccggacgatgctc
aagatcaagcactcgcgcaccgcggacgtcgtcgtggccggctaccggctgcacaagacc
tcgaccgacgagcggccgctgctcggctccctgctcctggggctctacgccgacgacggc
cagctgcagcatgtcggcgtcgcggcatccttcaccgaggcgcgccgggccgagctcatc
gccgagcttgccccgcttgtcgtcgaggcttccgaccacccgtggggccggtggcaggag
gcccaggcgcaggccggctcccggctgccgggtggccagagccgctggaccggcaccaag
gacctgtcgttcgtcacgctggcgccgaccagggtcgccgaggtcggctacgagcacatg
gagggcgacagattccggcacaccgcccagttcaagcgctggcgcgatgaccgcgagccc
gagtcgtgcacgtacgagcagctcgaggaggtcgccaagtacgacctggggcaggtgctg
acctga

DBGET integrated database retrieval system