KEGG   Aeromicrobium sp. A1-2: C6I20_14845Help
Entry
C6I20_14845       CDS       T05642                                 

Gene name
gabT
Definition
(GenBank) 4-aminobutyrate--2-oxoglutarate transaminase
  KO
K07250  4-aminobutyrate aminotransferase / (S)-3-amino-2-methylpropionate transaminase / 5-aminovalerate transaminase [EC:2.6.1.19 2.6.1.22 2.6.1.48]
Organism
aeb  Aeromicrobium sp. A1-2
Pathway
aeb00250  Alanine, aspartate and glutamate metabolism
aeb00280  Valine, leucine and isoleucine degradation
aeb00310  Lysine degradation
aeb00410  beta-Alanine metabolism
aeb00640  Propanoate metabolism
aeb00650  Butanoate metabolism
aeb01100  Metabolic pathways
aeb01120  Microbial metabolism in diverse environments
Brite
KEGG Orthology (KO) [BR:aeb00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00640 Propanoate metabolism
    C6I20_14845 (gabT)
   00650 Butanoate metabolism
    C6I20_14845 (gabT)
  09105 Amino acid metabolism
   00250 Alanine, aspartate and glutamate metabolism
    C6I20_14845 (gabT)
   00280 Valine, leucine and isoleucine degradation
    C6I20_14845 (gabT)
   00310 Lysine degradation
    C6I20_14845 (gabT)
  09106 Metabolism of other amino acids
   00410 beta-Alanine metabolism
    C6I20_14845 (gabT)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01007 Amino acid related enzymes [BR:aeb01007]
    C6I20_14845 (gabT)
Enzymes [BR:aeb01000]
 2. Transferases
  2.6  Transferring nitrogenous groups
   2.6.1  Transaminases
    2.6.1.19  4-aminobutyrate---2-oxoglutarate transaminase
     C6I20_14845 (gabT)
    2.6.1.22  (S)-3-amino-2-methylpropionate transaminase
     C6I20_14845 (gabT)
    2.6.1.48  5-aminovalerate transaminase
     C6I20_14845 (gabT)
Amino acid related enzymes [BR:aeb01007]
 Aminotransferase (transaminase)
  Class III
   C6I20_14845 (gabT)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Aminotran_3
Motif
Other DBs
NCBI-ProteinID: AXT86951
UniProt: A0A3B7DB48
LinkDB All DBs
Position
3019122..3020453
Genome map
AA seq 443 aa AA seqDB search
MSASIEQRRHLATSIPGPRSIELMARKKSAVAQGVGTTLPVFAIEAGGGIVKDVDGNQLI
DLGSGIAVTTVGNSAPRVVEAVREQVEAFTHTCFMVTPYENYVAVSEALNRLTPGDHDKR
TALFNSGAEAVENAVKIARAHTKKSAIVAFDHAYHGRTNLTMALTAKSMPYKSGFGPFAP
EVYRAPLSYPYRDAKDVDGAVAAQRAIMYIEKQVGADNLAAIVIEPIQGEGGFIVPADGF
LPALAQWCTANDVVLIADEVQSGFARTGAMFACDHEGVVPDLIVTAKGIAGGLPLSAVTG
RAEIMDAPHVSGLGGTYGGNPIACAAALATIETIEADGLVERAREIERLMLDRLNRLQAD
DDRIGDVRGRGAMIAVEIVKSGTDEPDPALTGAIAAAAHRAGVIVLTCGTYGNVLRFLPP
LSIGDALLNEGLDVVADALEETR
NT seq 1332 nt NT seq  +upstreamnt  +downstreamnt
atgtctgcctcgatcgaacaacgtcgtcacctcgccacctcgatccccggtccccggtcg
atcgagctcatggcccgcaagaagtccgccgtcgcccaaggagtagggacgacgctgccg
gtcttcgcgatcgaggccggcggcggcatcgtcaaggacgtcgacggcaaccagctgatc
gacctcggctcgggcatcgctgtgacaacggtcggcaacagcgcgccgcgcgtcgtcgaa
gccgtccgcgagcaggtcgaggccttcacccacacctgcttcatggtcacgccgtacgag
aactatgtcgcggtgtccgaggcgctcaaccggctcacgcccggcgaccacgacaagcgg
accgcactgttcaactccggcgccgaggcggtggagaacgcggtcaagatcgcccgtgcg
cacaccaagaagtcggccatcgtcgccttcgaccacgcgtaccacggccgcaccaacctc
acgatggcgctgaccgccaagtcgatgccctacaagagcggcttcggcccctttgccccc
gaggtctaccgcgctccgctgtcctacccctatcgggacgccaaggacgtcgacggggcc
gtcgcggcgcagcgcgcgatcatgtacatcgagaagcaggtcggcgccgacaacctcgcc
gcgatcgtgatcgagccgatccagggcgagggtggtttcatcgtcccggccgacggcttc
ctgcccgccctggcgcagtggtgtaccgcgaacgacgtcgtactgatcgccgacgaggtg
cagagcgggttcgcccggaccggcgcgatgttcgcctgcgaccacgaaggtgtcgtgccg
gacctgatcgtgaccgccaagggcatcgccggcggtttgccgctgtcagcggtgacgggt
cgcgccgagatcatggacgccccgcacgtttcgggactcggcggcacatacggcggcaac
ccgatcgcctgcgccgccgccctcgccacgatcgagacgatcgaggcagacggcctggtc
gagcgagcacgagagatcgagagattgatgctggaccgactcaaccggctgcaggccgac
gacgaccggatcggtgatgtccgtggtcgtggcgcgatgatcgccgtcgagatcgtcaag
agcggcaccgacgagcccgaccctgcgctgaccggcgcgattgcggctgccgcccaccgg
gccggcgtcatcgtcctgacctgcggcacgtacggcaacgtgctgcgcttcctgccgccg
ctgtcgatcggcgacgcactcctgaacgagggccttgacgtcgtcgcggacgccctcgag
gagacccgatga

DBGET integrated database retrieval system