KEGG   Aeromicrobium sp. A1-2: C6I20_14925Help
Entry
C6I20_14925       CDS       T05642                                 

Definition
(GenBank) ATP-dependent DNA ligase
  KO
K01971  bifunctional non-homologous end joining protein LigD [EC:6.5.1.1]
Organism
aeb  Aeromicrobium sp. A1-2
Pathway
aeb03450  Non-homologous end-joining
Brite
KEGG Orthology (KO) [BR:aeb00001]
 09120 Genetic Information Processing
  09124 Replication and repair
   03450 Non-homologous end-joining
    C6I20_14925
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03400 DNA repair and recombination proteins [BR:aeb03400]
    C6I20_14925
Enzymes [BR:aeb01000]
 6. Ligases
  6.5  Forming phosphoric-ester bonds
   6.5.1  Ligases that form phosphoric-ester bonds (only sub-subclass identified to date)
    6.5.1.1  DNA ligase (ATP)
     C6I20_14925
DNA repair and recombination proteins [BR:aeb03400]
 Prokaryotic Type
  DSBR (double strand breaks repair)
   NHEJ (non-homologous end-joining)
    Two-component NHEJ DNA repair complex
     C6I20_14925
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: LigD_N DNA_ligase_A_M DNA_ligase_A_C
Motif
Other DBs
NCBI-ProteinID: AXT86340
UniProt: A0A3B7D7A6
LinkDB All DBs
Position
3034308..3036683
Genome map
AA seq 791 aa AA seqDB search
MPRTSQTQTVSVAGHRLRLTHPDKVIYPETGTTKAEVMAYYMEIAPHLLPHLADRIVTRK
RWVDGVGSAADPGEVFFEKNLPSSAPDWIRRVEIEHRNHTTTYPVFDSAAALAWAGQVAA
LELHVPQWRVASHGVPQNPDRLVLDLDPGPGAGLPECVEVAKRARALLRELDLEAYPVTS
GSKGLHLYAGLDGQHDAEYVNRFAKQLALALESELPDLVVSSMKKSLRNGKVLVDWSQNN
GNKTTIAPYSLRGTSVPHVAAPRTWREMTADLQHLTMDEVLTRMKHRTDPLAALGGAAPS
EDRLATYRSKRDSAKTPEPVPELVPGGSHTTSFVIQEHHASSLHWDFRLERDGVLVSWAL
PKGVPTDPSKNHLAIQTEDHPLEYATFEGHIPRGEYGGGDVTIWDAGTFELEKWRDGKEV
IATLTGRAGGGLDQPRKYALIKTGKNWLIHLMEPKTRTDGPKAARMPARRLGDGFIAPML
ATLGSTKDIDESSDAWAFEMKWDGIRAVAVVDGSDVGLFTRNEKDVTAAYPEVVEALAAL
GLDDTVLDGEIVALDRAGAPDFGRLQRRMGLTRPAEIAAAQRHVSVEYMVFDLLRSEGRA
LAGESYDDRRTALLDLRIDGAVARVPLAFDGSLAKAVESSKALGLEGVLAKRRDSRYRSG
KRAQAWIKIKHRRMQEVVVGGWRTGLGARSGRIGALLLGIPDQGGLRYIGRVGTGFDERT
LTDLQRRLAGSPRKTSPFMDVPRDSARDAHWVTPRLVGEVSFAEWTASGQLRQPSWRGLR
TDKKPQEVALE
NT seq 2376 nt NT seq  +upstreamnt  +downstreamnt
atgccgcgcaccagccagacccagaccgtctcggtcgcgggccatcgcctccgcctcacg
caccccgacaaggtcatctaccccgagaccgggacgaccaaggccgaggtcatggcctac
tacatggagatcgcgccgcatctgctgccgcacctcgcggaccgcatcgtgacccgcaag
cgctgggtcgacggcgtgggctctgccgccgaccccggtgaggtgttcttcgagaagaat
ctcccgtcgtcggcgccggactggatccgacgcgtcgagatcgagcaccgaaaccacacc
acgacgtaccccgtgttcgacagcgccgcggcgctggcgtgggccgggcaggtggccgcc
ctcgagctgcacgtgccgcagtggcgggtcgcctcgcacggagtcccacagaatccggac
cgtcttgtgctggacctcgaccccggccccggcgcggggcttcccgagtgcgtcgaggtc
gccaagcgggccagggccttgctgcgggagctcgacctcgaggcgtacccggtcacgagc
ggcagcaagggccttcacctgtacgcaggactcgacgggcagcacgacgccgagtacgtc
aaccggttcgccaagcagctcgcgctggcgttggagtccgagctgcccgacctggtcgtc
agctcgatgaagaagagcctgcgcaacggcaaggtcctggtcgactggagccagaacaac
ggcaacaagaccacgatcgcgccgtactcgctgcgcgggacatcggtgccgcacgtcgcg
gcgccccggacctggcgcgagatgaccgccgatctccagcacctcacgatggacgaggtg
ctgacccggatgaagcaccgcacggatccgctggccgcccttggcggcgcggccccctcc
gaggatcgcctcgcgacctaccggtccaagcgggattcggccaagacccccgagcccgtg
cccgagctggtgcccggcggcagccacacgacgtcgttcgtgatccaggagcatcacgcc
agcagcctgcactgggacttccggctcgagcgcgacggcgtgctggtctcgtgggccctg
cccaagggggtgccgaccgatccgagcaaaaatcatctggcgatccagaccgaggaccac
ccgctggagtacgcgacgttcgagggtcacatcccccggggcgagtacggaggcggtgac
gtcacgatctgggacgccggcacgttcgagctggagaaatggcgagacggcaaggaggtc
atcgcgacgctcacgggccgagcgggcggcgggctcgaccaaccccgcaagtacgccctg
atcaagaccggcaagaactggttgatccatctgatggagccgaagacccggaccgacggg
ccgaaggcagcacgaatgccggcccggcggctgggtgacggcttcatcgcgcccatgctc
gcgaccctcggctcgacgaaggacatcgacgaatcgtcggacgcctgggcgttcgagatg
aagtgggacggcatccgggcggtcgcggtcgtcgacggaagcgacgtcggcctgttcacc
cgcaacgagaaggacgtcaccgccgcctatccggaggtggtcgaggctctggctgccctc
ggactcgacgacacggtgctcgacggcgagatcgtggccctcgaccgcgcaggcgcgccc
gacttcggccggctgcagcgccgaatgggtctgacccgcccagccgagatcgcggcggcg
cagcgacacgtgtcggtcgagtacatggtgtttgacctgttgcggtccgagggtcgtgcg
ctcgcgggcgagtcgtacgacgatcgacgcacggcgttgctggacctgcgtatcgacggt
gccgtcgcccgcgtccccctcgccttcgacggatcgctggccaaggcggtcgagtcgagc
aaggcgctgggtctggagggggtgctggccaagcgtcgcgacagccgctaccgcagcggc
aagcgcgcccaggcctggatcaagatcaagcaccgtcgcatgcaggaggtcgtcgtcggc
ggctggcgcaccggcctcggtgccaggtccggccgcatcggcgctctactgctcggcatc
cccgatcagggtgggctccgctacatcgggcgggtcggcactggcttcgacgagcgcacc
ctcacggacctgcagcgacggctcgcgggctcgccacgcaagaccagcccgttcatggat
gttccgcgtgactctgctcgcgatgcacactgggtgacaccacgcctggtcggcgaggtg
tcgttcgcggagtggaccgccagtggtcagcttcgtcagccaagctggcgcggactacgt
accgacaagaagccgcaggaggtagccctggagtga

DBGET integrated database retrieval system