KEGG   Acromyrmex echinatior (Panamanian leafcutter ant): 105142967Help
Entry
105142967         CDS       T03917                                 

Definition
(RefSeq) glycerol-3-phosphate dehydrogenase, mitochondrial isoform X1
  KO
K00111  glycerol-3-phosphate dehydrogenase [EC:1.1.5.3]
Organism
aec  Acromyrmex echinatior (Panamanian leafcutter ant)
Pathway
aec00564  Glycerophospholipid metabolism
Brite
KEGG Orthology (KO) [BR:aec00001]
 Metabolism
  Lipid metabolism
   00564 Glycerophospholipid metabolism
    105142967
Enzymes [BR:aec01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.5  With a quinone or similar compound as acceptor
    1.1.5.3  glycerol-3-phosphate dehydrogenase
     105142967
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: DAO DAO_C EF-hand_7 EF-hand_1 EF-hand_6 FAD_binding_2 FAD_oxidored EF-hand_8 EF-hand_9 Pyr_redox_2 EF-hand_5 GIDA FAD_binding_3 HI0933_like NAD_binding_8 Thi4 Pyr_redox_3
Motif
Other DBs
NCBI-GeneID: 105142967
NCBI-ProteinID: XP_011049209
LinkDB All DBs
Position
Unknown
AA seq 720 aa AA seqDB search
MASLRWFVAGASAVGAGTLTSYFLLSDTTVHAEMKWKPRPPRRTLPTREDQMKTLKSQDY
DVLIIGGGATGAGCALDACTRGLKTALVEADDFASGTSSRSTKLIHGGVRYLQKAILQVD
IEQYRMVKEALHERASMLESAPHLAHPLPIMLPVYTWWQIPYYWFGIKMYDLVAGSKTLK
SSYYLSKSNALELFPMLKGDKLTGAIVYYDGQQDDARMNLAIALTASRHGATVVNHVKVV
NLLKGLDKDGKRVLVGAHLKDELTGEEWDVKAKAIINATGPFTDHIRKMDDQSVQSICAP
SSGVHIVLPGYYSPEQMGLLDPATSDGRVIFFLPWQKQTIAGTTDLPCEVTHNPRPTEDE
IMFILQEVKNYLNPDVEVRRGDVLSAWSGIRPLVSDPNKPNTQSLARNHIVHVSPTNLVT
IAGGKWTTYRAMAQETIDAAIKACELKPERPCQTDGFLLEGAQGWSPTMYIRLVQDFGLE
CEVAQHLSKSYGDRAFAVAKMASLTGKRWPIIGKKIHPEFPYIDAEIRYGVREYARTAID
MIARRLRLAFLNVQAAQEALPGIIDIMAEELHWSAEEKKKQQSEASEFLAQEMGQMVNRA
SRDKIPINLTKDEIQLYIKRFRIIDKDKKGYVSINDIRRGLKLFGDKEVPGEELHEILRE
IDTNMNGQVELDEYLQMMSAIKSGHVAYSRFARMAEMEEAQHEKEILKKQISVERSGGGL
NT seq 2163 nt NT seq  +upstreamnt  +downstreamnt
atggcatcactcaggtggtttgttgctggagcaagtgctgtgggtgctggtacccttact
tcatatttcctcttgtcagataccacggtacacgctgaaatgaagtggaaaccaagaccg
cctcgaagaaccttgccaacacgagaagatcaaatgaaaactttgaaatcgcaggactat
gacgttttaataatcggaggcggtgcaacgggagcaggatgtgctctggatgcttgcaca
cgaggtctaaaaactgcattagttgaagccgatgactttgcatctggcacatcatcccgc
agcacaaagttaattcatggtggcgtacgatatctgcagaaagcgatcttgcaagtggac
atagagcaatatagaatggtgaaagaagcacttcacgaacgtgcatcaatgctggaaagc
gcaccacatctggcacatccattgcctattatgctgcctgtttacacgtggtggcaaatt
ccttattactggtttggcattaagatgtacgatctggtagcgggtagcaaaaccctcaaa
tcatcatattatttgagtaaatcgaacgctctggaactttttccgatgctgaaaggcgac
aaactaacgggagctattgtctattatgacggccaacaagatgatgccagaatgaatctg
gccattgctctaacagcttcgagacacggtgcaacagtcgtaaatcatgttaaagtagtc
aatttattaaagggtctcgacaaggatggcaaacgagtccttgtgggagctcatcttaaa
gatgaactcacaggagaggaatgggatgtaaaggccaaggcgataattaatgcgactggt
cccttcaccgatcatattagaaagatggacgatcaaagtgtccaatctatctgcgctccg
tcttccggtgttcacatagtattgccaggatattacagtcctgagcaaatgggtctactc
gatccagcaacgagtgatggtcgggtgattttctttttgccatggcaaaagcaaacaatt
gcaggaacaaccgatttgccttgcgaggtaacacacaatcctcggcctacggaagacgag
atcatgtttattctgcaggaagtgaaaaattacctgaacccagacgttgaggtgcgccgc
ggagacgttctttctgcctggagcggtattaggccgcttgtttccgacccgaataaaccg
aatacgcagtcactcgctaggaatcacatcgtgcacgtcagtcctacgaatctcgtcacg
atagcaggcggcaaatggacgacttaccgagcgatggctcaagaaactattgacgcggct
ataaaagcttgcgagctaaaaccagaaagaccctgccagacggatggctttcttctggaa
ggcgctcagggctggagccccacaatgtacattagattggtgcaagatttcggtctggaa
tgtgaggtcgcgcagcatttgtccaagagctatggagatcgtgcatttgccgtagctaaa
atggcctcgcttacagggaaacgatggcctattattggaaagaaaattcatccggaattt
ccatatatcgatgctgaaatacgctacggtgtacgggaatacgctagaactgcgatcgac
atgattgcgcgtcgattacgactcgctttcctaaatgtccaagcggctcaagaagcactg
ccgggtatcatagatatcatggccgaggaattgcattggtcagcagaggagaagaagaag
cagcagagcgaggccagcgagtttctcgctcaagagatgggtcagatggtgaaccgtgct
tctcgcgacaagattcctatcaatctcaccaaggatgagatccaactctatatcaagcgc
ttccgaattatagacaaagataagaaaggatatgtgtctatcaatgacattagacgagga
ttaaagctctttggagataaggaagtaccgggtgaagaacttcacgaaattctgcgtgaa
atcgacaccaatatgaacggtcaagttgaattggatgaatatcttcagatgatgtcagct
ataaaatctggtcatgtagcatattcacgttttgcgcgaatggctgaaatggaagaagca
caacatgaaaaggaaatactcaagaaacaaataagcgtcgagagatcagggggaggacta
taa

DBGET integrated database retrieval system