KEGG   Acromyrmex echinatior (Panamanian leafcutter ant): 105143828
Entry
105143828         CDS       T03917                                 

Definition
(RefSeq) LOW QUALITY PROTEIN: adenylate cyclase type 3
  KO
K08043  adenylate cyclase 3 [EC:4.6.1.1]
Organism
aec  Acromyrmex echinatior (Panamanian leafcutter ant)
Pathway
aec00230  Purine metabolism
aec01100  Metabolic pathways
aec04213  Longevity regulating pathway - multiple species
Brite
KEGG Orthology (KO) [BR:aec00001]
 09100 Metabolism
  09104 Nucleotide metabolism
   00230 Purine metabolism
    105143828
 09150 Organismal Systems
  09149 Aging
   04213 Longevity regulating pathway - multiple species
    105143828
Enzymes [BR:aec01000]
 4. Lyases
  4.6  Phosphorus-oxygen lyases
   4.6.1  Phosphorus-oxygen lyases (only sub-subclass identified to date)
    4.6.1.1  adenylate cyclase
     105143828
SSDB
Motif
Pfam: Guanylate_cyc AC_N DUF2258 RGCC
Other DBs
NCBI-GeneID: 105143828
NCBI-ProteinID: XP_011050638
LinkDB
Position
Unknown
AA seq 1003 aa
MSQQAPTNEDSYLRCGRPSNLLKTSFSSARLEKLYRASSLQQRRGGLTCFLMSAILYGLY
TVSTPGMELPARCVSAVFLSLNFFLLVWAESGTKARNSLWSVVPCVVGELWIVHLSAQLF
LKSNKVTPMDSLAWMLLLLYLLFATLPLKLLRCANLAASSILLYLIAIIGLSSKTLEDLT
SQPIDVLVGNSXQLTAMYSILGACGYYLAEFQQRRAFLETRQSLEVQLMIEEQSAEQERL
LLSVLPEHVAVKMRQDLGASFDTQFKKIYMSRHENVSILYADIVGFTAISSTYSASELVK
ILNELFARFDQLSERYEQMRIKILGDCYYCISGAPVERPDHAVLCVYMGLSMVEAIKYVQ
QTTNSPVDMRVGIHTGAVLAGVLGQRQWQFDVYSKDVELANKMESSGRAGRVHISNSTLS
FLNGEFEVEPAHGEDREEALQKAGLVTYFIVRALKPFKPAVTKSLASLADAENSQRIIEN
VQDKVDNIREDSEEFQQRLRKKLDSRGGGTDLKGHASWLTLRFKDPNVETAFHSVEEAFS
PLSLLGGPLVTMCAAPVWKMQPWGPFTWGGAGVVTLFGIVLAGATCLGSAVRAAWFRSTL
ALLMIFSLIIFLLLDMANCAIIDDTEPLKNTTLKWSPRCPYPSYYSYVGVLALVAISMPT
YLCYLTKACLMYFLAGAQSCINVLFLASSLDREEMACRRDTIYFPLKYSLAATLFTIATA
LVIVARYAEKARRMLYLRGREVIAQRERAADMKRRNGALIYNILPPHVAAYFLSHARHYD
DLYSQSYAEVGVLFASMPNFADFYSEESINNQGLECLRFLNEVISDFDAILDQKKFHSII
KIKTIGSTYMASSGISEVQSVQSEDAPRWSHLVTLVEFALELKKALSSINEQSFNHFVLK
MGINHGPVTAGVIGARKPHYDIWGNTVNVASRMESTGKVGCIQVTDETRKILEPFGFGFE
QRGLVFVKGKGQLLTHYLVSKDGVFLDLDSDLPVEPTHPIIYQ
NT seq 3012 nt   +upstreamnt  +downstreamnt
atgtcgcagcaggctccgacgaacgaggattcttacctgaggtgtggcaggccgtcgaac
ttgctgaagacgagctttagcagcgcccgcctcgagaagctgtatcgcgcgtcgtcgttg
caacagcgtcgcggcggcctcacgtgtttcctgatgtcggcgatcctgtacggcctctat
acagtgtcgacaccgggaatggagctgccggcgcgttgcgtcagcgccgtgttcctcagt
ctcaacttcttcctgctggtttgggccgagagcggcaccaaggcgcgtaactcgctctgg
tcggtggtgccgtgcgtggtcggagagctatggatcgtgcacttgtctgctcagctgttc
ctcaagtccaacaaggtcacgccgatggacagcctggcgtggatgctgctgcttctctac
ctactgttcgccactttaccgctcaagctattacgttgtgctaacttagcagcaagcagc
attctcttgtacttaatcgccataatcggtctctccagcaagacactggaggatcttaca
tcacagcctatcgacgttctggtaggtaacagctaacagctaacagcgatgtactctatt
ttgggtgcctgcggctattacctggcggagttccagcagcgccgtgcgtttttggagacc
aggcagagcctggaggttcagctgatgatcgaagaacagagcgcagagcaggagcgactg
ttgctgagcgttctgccggaacacgtcgcggtcaagatgcggcaggatctcggcgcgtct
ttcgacacgcaattcaagaagatctatatgtctaggcacgaaaacgtgtcgatactctat
gctgacatagtcggcttcaccgcaatttcgtcgacctacagcgccagcgagctagtcaag
atactcaacgagctcttcgcgcgattcgaccagctcagtgaacgatacgaacaaatgcgc
atcaagatcttaggggattgttattactgcataagtggcgcacccgtcgaaagaccagat
cacgcggtcctttgtgtgtatatgggtctgtctatggtggaggcgattaaatatgttcaa
caaacgaccaacagccccgtcgacatgagggtgggcattcacacgggtgcggtactcgcc
ggggtcctcggacagaggcaatggcagttcgacgtctacagcaaagatgtcgaactggca
aataagatggagagtagtggtagagcggggagagtacacatctcgaattcgacgctgagt
ttcttaaatggggaattcgaggtcgagccggcacacggggaagatcgggaagaggcactc
caaaaagctgggctcgtcacttacttcatcgtaagagccttgaaaccatttaagccagcg
gtgacgaaaagcctcgcgtcactggcggacgcggaaaactcgcaaagaataatagagaat
gtgcaagacaaagtggacaatattcgagaggattccgaggaatttcagcaacgtctaagg
aagaaacttgacagcagaggtggtggaactgacctgaaaggtcacgcctcttggttgaca
ctacggttcaaagatccgaacgtggaaacggcgtttcacagcgtcgaggaggccttctcg
cccctgtcgcttcttggtggacctctggtcacgatgtgcgcagccccggtttggaagatg
cagccctggggaccgttcacgtggggtggcgccggggtagtaactcttttcggcatcgtg
ctggccggagctacctgcctgggcagcgctgttagggcggcgtggttcaggagtaccctc
gcactcctgatgatattctccctcataatctttctgctgttagatatggctaactgcgcg
attatcgacgataccgagccactgaaaaacaccaccctaaagtggtctccgcgatgtcca
tacccttcttactactcatacgtcggcgtccttgcgctggtcgctatctcgatgccgaca
tatctctgttacctgaccaaggcgtgcctgatgtacttccttgccggcgcgcaatcctgc
atcaatgtcctgttcctcgcatcgagcctcgacagagaagaaatggcgtgtcgtcgggac
accatatactttccactaaaatattcgttagcagccactttgttcactatcgcgaccgcg
ttagtcatcgtggcgagatacgccgagaaggcgcgaaggatgctgtatttacgaggacga
gaggtaatcgcgcaaagggaacgggcagcggacatgaaacgaagaaacggagcactaata
tacaatatcttgccacctcacgtagccgcgtatttcctatcgcatgcaaggcattacgac
gatctttacagccagagctacgccgaggtgggcgtgctatttgccagtatgccaaacttc
gcggacttctacagcgaggagagcatcaacaatcaaggcctcgagtgcctcaggttcctg
aatgaggtcatctctgacttcgacgccatcctcgatcaaaagaaattccatagtatcatc
aagatcaagacgataggatcgacctacatggcctcttcgggaatatccgaggtgcaatcg
gtgcagtcggaggatgctcctcgatggagccacctcgtcactcttgtggagttcgctctg
gagcttaagaaagccctgtcaagcattaacgagcagagttttaatcacttcgttttgaaa
atgggcattaatcatggaccggtgactgctggcgtcatcggggcgcggaaacctcactac
gatatttggggcaacaccgtcaatgtcgcgtcgagaatggagagcacggggaaagtcggc
tgcattcaggtcaccgacgagacacgaaagatactggagccatttggtttcggctttgaa
caacgaggtcttgtcttcgttaagggcaagggacaactcttaacgcattatcttgtttcc
aaagatggcgtctttctcgatcttgacagcgatctccctgttgaacctacccatccgata
atctatcagtaa

DBGET integrated database retrieval system