KEGG   Acromyrmex echinatior (Panamanian leafcutter ant): 105144272Help
Entry
105144272         CDS       T03917                                 

Definition
(RefSeq) 4-aminobutyrate aminotransferase, mitochondrial isoform X1
  KO
K13524  4-aminobutyrate aminotransferase / (S)-3-amino-2-methylpropionate transaminase [EC:2.6.1.19 2.6.1.22]
Organism
aec  Acromyrmex echinatior (Panamanian leafcutter ant)
Pathway
aec00250  Alanine, aspartate and glutamate metabolism
aec00280  Valine, leucine and isoleucine degradation
aec00410  beta-Alanine metabolism
aec00640  Propanoate metabolism
aec00650  Butanoate metabolism
aec01100  Metabolic pathways
Module
aec_M00027  GABA (gamma-Aminobutyrate) shunt
Brite
KEGG Orthology (KO) [BR:aec00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00640 Propanoate metabolism
    105144272
   00650 Butanoate metabolism
    105144272
  09105 Amino acid metabolism
   00250 Alanine, aspartate and glutamate metabolism
    105144272
   00280 Valine, leucine and isoleucine degradation
    105144272
  09106 Metabolism of other amino acids
   00410 beta-Alanine metabolism
    105144272
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01007 Amino acid related enzymes [BR:aec01007]
    105144272
Enzymes [BR:aec01000]
 2. Transferases
  2.6  Transferring nitrogenous groups
   2.6.1  Transaminases
    2.6.1.19  4-aminobutyrate---2-oxoglutarate transaminase
     105144272
    2.6.1.22  (S)-3-amino-2-methylpropionate transaminase
     105144272
Amino acid related enzymes [BR:aec01007]
 Aminotransferase (transaminase)
  Class III
   105144272
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Aminotran_3 Aminotran_1_2 TIM
Motif
Other DBs
NCBI-GeneID: 105144272
NCBI-ProteinID: XP_011051377
LinkDB All DBs
Position
Unknown
AA seq 498 aa AA seqDB search
MLVNKYHRALSGRISLRQLLNGITTWKRCLTGSMPREPEGPVLMTEIPGPRSRSLLQELS
SIQQASSVQFFADYEKSAGNYIIDVDGNVLLDVYMQISSMPLGYNHPAMLEALADPVNQR
IIVNRPALGVFPGKDWPNRLRDVLLKKELAPPGLSHITTMMCGSCSNENAFKNIFIWYAE
KQRQGKPFTKEEIESCMMNQIPGSPRYSIMSFKGSFHGRTLGCLSTTHSKYIHKMDIPAF
DWPIASFPEYKYPLEENVRENKQEDKRCLAEVEELFEKYKNEKKIPVAGVIIEPIQAEGG
DNHASPEFFQELQRLIRKYGAALLVDEVQTGGGPTGKMWCHEHFNLDTPPDIMTFSKKMQ
LGGYYHSEDLKPKLSYRVFNTWMGDPSKVILLETIIKTIKKENLLDRVTCVGNYLLKHLM
DMQKEHTNVISAVRGRGTFIAFNCPSSEARDSIIKKLATKGIQTGGCGSQAVRLRPALTF
TEHHADIFLDTLRSILKK
NT seq 1497 nt NT seq  +upstreamnt  +downstreamnt
atgcttgttaacaagtatcatcgtgcgttgagtgggcggatctcgctccgacagctgcta
aacggcattactacgtggaagagatgcttaaccggttcgatgccgagggaacctgaaggg
ccggtacttatgaccgaaataccaggccctcgatcgcgcagcttgctacaagaattaagt
tcgatacaacaagcgtcttccgtacaattcttcgcagactatgaaaaatccgccggtaat
tacataattgacgttgatgggaatgtgttgctggacgtttatatgcaaatctcatcaatg
cctctagggtacaatcatccggcgatgctggaggctctcgccgatcccgttaatcaaaga
attatagtgaatagacctgctttaggtgtctttccaggaaaagactggcctaatagatta
agagatgttctacttaagaaagagttagcaccaccgggattatcacacattacgacaatg
atgtgcggttcttgttctaatgagaatgcttttaaaaacatttttatctggtacgccgag
aaacaaaggcaaggcaaaccgttcacgaaggaagagatagaatcgtgtatgatgaaccaa
atccctggctcaccgcgatactctattatgtcctttaaaggtagctttcatggaagaacc
ttaggttgtctctcaacgactcacagcaagtacattcacaagatggatataccagctttc
gactggcctatcgcctcctttccagagtacaaatatcctttagaagaaaacgtgcgagaa
aacaagcaggaagataagcgttgcctcgcagaggtcgaggaattatttgagaagtacaaa
aacgaaaagaaaataccagtggctggtgtgataattgaacctattcaagcagaaggcggc
gacaatcacgcatccccagaattctttcaggaacttcaacgcttgatacgaaagtatgga
gccgcgttacttgtcgacgaagtgcaaaccggtggcggaccaacgggaaaaatgtggtgc
cacgagcactttaatttagatactccacccgacataatgactttcagcaagaaaatgcaa
ttaggcggttattatcattcggaggatctgaaaccgaaactgtcatatcgtgtgttcaat
acttggatgggcgatcccagcaaagtgatcctgctcgagacgattataaaaacgattaaa
aaagagaatcttttggatagagttacgtgcgtgggcaattatctgttaaaacatttgatg
gatatgcaaaaggaacataccaatgtaattagtgcagtgcgcggacgtggtactttcata
gcatttaattgcccctcgtctgaagcgcgagatagcatcatcaagaaacttgcaacgaaa
ggtattcagacaggtggctgcggcagccaggctgtgcggctgaggcctgcgttgaccttc
acagagcatcatgccgatatatttctggatacgcttcgctctattttaaaaaaataa

DBGET integrated database retrieval system