KEGG   Acromyrmex echinatior (Panamanian leafcutter ant): 105144959Help
Entry
105144959         CDS       T03917                                 

Definition
(RefSeq) probable histone-lysine N-methyltransferase CG1716 isoform X1
  KO
K11423  histone-lysine N-methyltransferase SETD2 [EC:2.1.1.43]
Organism
aec  Acromyrmex echinatior (Panamanian leafcutter ant)
Pathway
aec00310  Lysine degradation
Brite
KEGG Orthology (KO) [BR:aec00001]
 Metabolism
  Amino acid metabolism
   00310 Lysine degradation
    105144959
Enzymes [BR:aec01000]
 2. Transferases
  2.1  Transferring one-carbon groups
   2.1.1  Methyltransferases
    2.1.1.43  histone-lysine N-methyltransferase
     105144959
Chromosome and associated proteins [BR:aec03036]
 Eukaryotic Type
  Histone modification proteins
   HMTs (histone methyltransferases)
    HKMTs (histone lysine methyltransferases)
     105144959
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: SRI SET WW
Motif
Other DBs
NCBI-GeneID: 105144959
NCBI-ProteinID: XP_011052529
UniProt: F4WGJ7
LinkDB All DBs
Position
Unknown
AA seq 1841 aa AA seqDB search
MARRRKTEVKASEKSSHKYIPVRKSSRQIAKKQLEEKKINGYITQTSCSNSSEEFKSTSE
GHSQVLSKKNQNSLKKHNKCKGTSSNSVIVNSEYALYNAIQHKRDTGESDSQDDMDNMIK
NSEKLSPEDVQQVVIGNPSPTNESLPASTPASTPASTKAETWSEEVIEEMIICEEMQVEQ
DVGDNHYSLAQSDVIVEEVLLENESNLENKNFVEFTVIQNEDDNESMISKSEKILNTEYH
AIKQNVINNVHMNKSENSISAIHTDELVTSCSSGNNNATDSNTDKSYINKKKVLLEAGSK
KQKKTIYDKITKEISESMANKIYLCSTKDDSGSSTEEDNCKRECKDLKAKNMNIDSSKED
SFNKIDNKLANMQISESSQEIQKLVNDLSSVESADSLIQTPLNMEKLSPVQLNIDDESSS
SILDKMEQLHRSNDSVSSNDKEIFLKTVEPNNIIKNQEQNILESNSCIDRLQCTDRVSLK
SKITQDKKNTSQQKNSEYLTTTDEYQDSEGDKVDNEDIKLCSSSENSNDTLSSLTNYKGR
EFDIKNAINNTNDVDKKMEFRGRSGSTDTSSENSSNSSGVRRSSRIRSIGLMKQRSRGRG
LVTKPNIDTSKAVLQQEKEKVVNTNSSITQEVKVDNFETQCDKENNSNKISTSIDTLTPL
STSYSITGYDSDSSKPVKVKSRWRRSSELEMGGSNAGFGSIIAPVSMLGSSIALQSESGR
NAPINIGESTSSELKHNAVNTSIKFCTEIGQIKDVSVVSSNVSTILTVAQIPKTVGAKIS
LPMVLELEDREMEERLSQFEHLYENLYLTERYTNKETKRMVCDCFLTEEEIERGELGCGE
DCLNRLLMIECGPRCVVGDRCTNKRFQNCQYAKCEVFRTEKKGFGLRAVVDIMAGEFIME
YVGEVVDPKDFRRRAKEYSKDKNRHYYFMALKSDQIIDATMKGNISRFINHSCDPNAETQ
KWTVNGELRIGFFNKKFIAAGEEITFDYHFQRYGKEAQKCYCEALNCRGWIGETPEEEKE
KIEKKETEERDTKKKMEEKKPTDDYMEDEDLEEEIDKLCSGGLKNRAHTLTLSRLMVRSR
ELEHRTRLLRLIQSGEQPCRRLFLDYHGLRLIWSYVMDISTNESEEAQQFRLDVLKTLNT
LPIPNKTMLMDSKIYGVIERWAKKLYLSPNTDSPEDDQIKSKTSCEELNSNSDSSEKKSL
DERLNDIPDKSNNNIESCLAVVSEVKSENTDLIPDLASSLLAEWSNLKEVFRIPKKERIE
QMKEHEREADRGYREELEKEEEKRITSYDRHRSDRYNRSDIDKRGDRRRGRESPEADHSR
IDHNRTKDKRVEERSLVPIPRMTKYERRQLFALQVAKEEEERQRRQQQESWQEHENRCLA
LGIDPHTTAMVDPQTGYPVFYNPTLGQWQHYSTQDGGEVTQQCTPVYVGNAPSTGIIGQS
PHVLSSSMTNDMPSGISTGIPPGVPPPVAYSLSQTPVFSQTSSYSLISHPQPYTEGQLPL
SNSLVSVLYGISSTSIKTLLHNHIKNPAGQQFPNLTSTENVTSRPQPEVPAIDLPPKWKS
ATDNRGRTYYYHVKERISQWLPPPPDHIGVQPDSSSTSESSDESSSSNEDDEDIDDDHTE
DQRNDDMEASSVLTDSPLSTSRPNVSKKLSGHNLTGSSLPFPESKKRRDGLVQERIISPR
REDDRLDHKTYKEMKDKLRRQKERTKLKDHVEKLRKHRRSNKSKSYSRHGMNKLQSTSAE
MSPMSERKIKDTFRINMANVMVHFLNPYRKNDCKQGRITNTEDFKHLARKLTHFVLAKEL
KHCKSVDELQCNENVKHKARDFVRKYMSKFGAVYQKGTDED
NT seq 5526 nt NT seq  +upstreamnt  +downstreamnt
atggcacgcagacgtaaaaccgaagtaaaagcatctgagaaatcatctcataaatatata
cctgtacgtaaatctagcagacaaatagctaagaagcaattagaagaaaaaaagataaat
ggatacatcacgcaaacatcttgctcaaacagttcagaagagtttaagtctactagcgaa
ggtcatagccaagttctttctaagaaaaatcaaaattctctgaagaaacataacaaatgt
aaaggtacttccagcaacagtgtaattgtaaatagtgaatatgctttatacaatgctatt
caacataaacgagatacgggtgaaagtgatagtcaagatgatatggataatatgattaaa
aattcagaaaaacttagtccagaggatgtacagcaagttgttattggtaatccaagtcca
accaatgaatctttacctgcatctacacctgcatctacacctgcatcaaccaaggctgaa
acgtggtcagaagaggtcatagaggaaatgataatctgtgaagaaatgcaagtggagcaa
gatgttggtgacaaccattattctttggcacagagtgatgttatagttgaagaggtatta
cttgagaacgaatctaatctagaaaacaaaaattttgtagaatttactgtgatacagaat
gaggatgataacgaatctatgatatctaagtcagaaaaaattttgaacactgaatatcat
gctattaaacaaaatgttataaataatgtacatatgaataaatcagaaaattccatatca
gccatacatactgatgaattggtaacttcatgcagtagtgggaataataatgccacagat
tctaatacagataaatcttatatcaataaaaagaaagttttattagaagctggaagtaaa
aaacaaaaaaagacaatttatgataaaattacaaaggaaatttcagaatcaatggccaac
aaaatttatttatgttccactaaagatgattctggttcttctactgaagaagataactgc
aaacgggaatgtaaagacttaaaagcaaaaaatatgaacatagattcgtcaaaggaagat
tcttttaataaaatagataataaactggcaaatatgcagataagtgaatcttcacaagaa
atacaaaaattagtgaatgacctgtctagtgtggaaagcgctgattctctgatacaaact
cctttaaatatggaaaaactgtctccagtacaactaaatattgatgacgaaagtagttcg
tcaatattggataagatggagcagttacatcgctcgaatgattctgttagttctaacgat
aaggaaatattcttgaaaactgtagaacctaacaatattattaaaaatcaagaacaaaat
attttagaatccaactcttgcattgatagacttcaatgtacagatcgagtttcattaaaa
tcgaaaattacacaagacaaaaagaatacaagtcagcaaaagaattcagaatatttaaca
actactgatgaatatcaagatagtgaaggagataaagttgataatgaagatattaaacta
tgcagcagcagtgaaaatagtaatgatacattgtcatcccttactaattacaaaggacgg
gaatttgacataaaaaatgcaattaacaatacgaatgatgttgataaaaaaatggaattc
agaggtcgcagtggaagcactgatacaagttctgaaaatagttcaaacagttcaggtgta
agacgaagtagtagaattcgatctattggattgatgaaacaaagatctcgcggacgtggt
ttggttacaaaacctaatatagacacctcaaaagctgttcttcagcaagaaaaagaaaaa
gttgttaatacgaattcttcaattactcaggaagtaaaagtagataactttgagactcag
tgtgataaagaaaataattctaacaagatttcaacgtcgattgatactttaacaccttta
agtactagttatagtatcacaggatatgattctgactcttcaaaaccagttaaagtaaaa
tcgcgttggcgaagatcgagtgaacttgaaatgggtggatcaaatgcaggatttggatct
atcattgcacctgtatcaatgcttggatcatctattgcacttcaatctgaatcaggacgt
aatgcaccaataaatataggagaatctacatcatcagaattaaaacataatgctgttaat
acaagtataaaattttgtacggaaatagggcaaattaaagatgtatcagtggtatccagt
aatgtttctactattttaacagtagcacaaattccaaaaactgtaggagcaaagatttcg
ttgccaatggttctcgaactagaagatagagaaatggaagaaagactgagtcagtttgaa
cacttatatgaaaatttgtatcttacagaaagatatacaaacaaggaaaccaaaagaatg
gtatgcgattgtttcttaactgaagaagaaattgagagaggagaacttggttgtggagaa
gattgccttaatagacttctcatgatagaatgtggacctagatgcgtagtaggtgataga
tgtacaaataaaagatttcaaaattgtcaatatgccaaatgtgaagtttttcgaacagag
aagaaaggttttgggttacgtgctgttgttgacataatggcgggcgaatttataatggag
tatgtaggtgaagttgtagatccaaaggattttagacgtcgagcaaaagaatactccaaa
gataaaaatagacattattattttatggcgttgaaatctgatcagattatagatgctacg
atgaaaggaaatatatcccgattcattaatcacagttgtgatccaaatgcggagacgcaa
aagtggacagtaaatggggaattacgaataggcttttttaacaaaaaattcatagctgct
ggcgaagaaattacatttgactatcattttcaacgttatggcaaagaagctcagaagtgt
tattgtgaggcactgaattgtcgaggttggataggtgaaacaccagaggaagagaaagag
aaaattgaaaagaaagaaacagaggaaagagatacgaagaagaagatggaagaaaagaaa
ccaactgatgattatatggaggacgaggatttggaggaagaaatagataaattgtgttca
ggtggtttgaaaaaccgtgcgcacactttaacattaagtagattaatggttcgtagcaga
gaattagaacacagaacacgtttgttacgtcttattcaaagtggtgaacaaccatgccga
agattgtttttggattatcacggattacgtttgatttggagttatgttatggatattagt
acaaacgaatcggaagaagctcaacaatttcgcttagatgtgctgaagactctaaataca
ctgccaataccaaacaagacaatgttaatggatagtaaaatatatggtgtaattgaaaga
tgggcgaaaaaattatatctttctccaaatactgattctccagaagatgatcagattaaa
tcaaagacgagctgtgaagaattgaatagtaattctgacagcagtgagaaaaaaagtctt
gatgaacgtctaaatgacattccagataaaagtaataacaatatcgaaagttgtttggca
gttgttagtgaagtcaaatcagagaatacagatcttattcccgatttagcttctagtctt
cttgctgaatggtctaatttaaaagaagtttttagaataccaaaaaaagagagaattgag
caaatgaaggagcatgaaagagaagcagatcgaggatacagagaagaattagagaaagaa
gaagaaaaaagaatcacctcgtatgatagacatagatctgatagatataatcgaagtgat
atagacaaacgtggtgataggagacgaggacgagaatctccagaagctgatcatagtaga
attgatcataatagaacaaaagataaaagagtagaagaacggagtctagttcctatacca
cgaatgacaaagtacgaacgtaggcaattatttgcattgcaagttgcaaaagaagaagaa
gaaaggcaacgtcgtcaacaacaagaatcgtggcaagaacatgagaatagatgtttagca
ttgggtatagatccccatactactgccatggttgacccacaaactggttatcctgttttt
tataatccaactctaggtcaatggcaacattattccactcaagatggtggagaagtgaca
caacaatgtactcctgtatatgtaggaaatgctccatctactggtataataggtcaaagt
cctcatgtattatcatcatcaatgacaaacgatatgccatccggaatttcgactggtatt
ccacctggtgtaccaccaccagtagcttactcattaagtcaaacgcctgtgttcagtcaa
acatcttcctactctttgatatcgcatccgcaaccatatactgaagggcaactacctctt
tcaaacagtttagtgtctgttctttatggcatttcttctacatcaattaaaacgcttctt
cataaccatatcaaaaatcccgcaggtcaacaattccctaatcttacgtccacggaaaat
gtcacgagtcgaccacaacctgaagttccggcaatagatttgccaccgaaatggaagagt
gcgacggataacagaggtagaacatactattatcacgtgaaggaaagaatatcgcaatgg
ttacctccaccacccgatcatattggagtacaaccagattcgtcgtctacctcggaatct
agtgatgaatccagttcatcaaatgaggatgatgaagatattgatgatgatcatactgaa
gatcaaagaaacgatgatatggaggcaagtagcgttctaacagacagtcctttgagcaca
tctagaccaaatgtatctaaaaaattaagtggccataatttgactggaagttcactgccg
tttcccgaatctaagaagagaagagatggattggtccaagaaagaattattagtccacgt
agggaagatgatcgtcttgatcataagacgtataaggaaatgaaagataaattacgacga
cagaaagaaaggacaaaactaaaagatcatgttgagaaattaagaaaacatagacgaagt
aataaatcgaagtcttactcgcgacatggaatgaacaaattgcaatcaacatcagctgag
atgtctcctatgtcagaaaggaaaattaaagatacatttagaataaacatggctaatgtg
atggttcacttcttaaatccatatagaaaaaatgattgcaaacaaggtagaataactaat
actgaagatttcaagcatctagctagaaagttaacacattttgtacttgcaaaagaatta
aaacattgtaaaagcgtggacgaattacaatgtaatgaaaatgttaaacataaagcaaga
gattttgtacgtaagtacatgagcaagttcggggcagtgtatcagaaaggtacagacgag
gattag

DBGET integrated database retrieval system