KEGG   Acromyrmex echinatior (Panamanian leafcutter ant): 105145111Help
Entry
105145111         CDS       T03917                                 

Definition
(RefSeq) lysosomal alpha-glucosidase-like isoform X1
  KO
K12316  lysosomal alpha-glucosidase [EC:3.2.1.20]
Organism
aec  Acromyrmex echinatior (Panamanian leafcutter ant)
Pathway
aec00052  Galactose metabolism
aec00500  Starch and sucrose metabolism
aec01100  Metabolic pathways
aec04142  Lysosome
Brite
KEGG Orthology (KO) [BR:aec00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00052 Galactose metabolism
    105145111
   00500 Starch and sucrose metabolism
    105145111
 09140 Cellular Processes
  09141 Transport and catabolism
   04142 Lysosome
    105145111
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:aec04147]
    105145111
Enzymes [BR:aec01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.20  alpha-glucosidase
     105145111
Exosome [BR:aec04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   105145111
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Glyco_hydro_31 NtCtMGAM_N Trefoil Gal_mutarotas_2 DUF5110
Motif
Other DBs
NCBI-GeneID: 105145111
NCBI-ProteinID: XP_011052775
LinkDB All DBs
Position
Unknown
AA seq 1038 aa AA seqDB search
MADVEASGQDVSEKSGYYSATKDRPNKIMEKFNTVVVKTLNNKFYEPSMKKYEKEELNLD
KRHNVKRIIITLFLGLITALLLCHLGLPLLYAIINPLRTVNSYNAEVEFMIDINNDSIEE
TRYQHILVDTPDIYIEQETYDRKIVPLKEESNLSEENTAFNNAQQCSNVPEILRFDCHPE
NGASQLSCINRGCCWNPRKNNKNEKDVSLDIPYCFYPDGWNLYKYINRSQDGSNFLGFLS
QEKKSVYKNNVPLVKIEATSINSSILRVKIYDPIKTRYEPPWPIRSDPKPFLYQVVDTKY
QFNTDDIKPGFKVNRISDGTTLFNSIGIGGFIFADQFLQISSLLPTSNIYGIGGHQSNLK
LNTNWQIFTLFNLDQAPMENANLYGSHPFYIVMEESGMAHGVLFLNSNAMDVILQPTPAI
TFRTIGGIFDIYFFLGPTPADVVKQYSEIVGKPFMPPYWSLGFHLCRYGYESLENTKAVW
NRTRTAGIPFDTQWNDLDYMDKNNDFTYNKEKFKDLPKFVEEIHSIGMHYIPLIDAGISA
FEDNGSYLPYVEGIKQDIFVKDGESDKPFIGKVWNFFSTVWPDFTNPKTMIYYANMMGDM
HNNFTYDGAWIDMNEPANFYNGNKNGCTHNNLDYPEYIPNVVGGLLATKTFCMNAKHYLG
THYNLHNTYGTSQAITTNYALRKIRLKRPFIISRSTWIGHGHYAGHWTGDVYSSWHDLKM
SIPAILSFNFYQIPMVGADICGFNGNTTIALCNRWMQLGAFYPFSRNHNSDDTIEQDPVA
MGDLVVQSSKNSLKIRYRFLPYLYTLFFRAHKFGETVVRPLFFEFTEDRQTYDIDKQFLW
GNSLMINPVLEENKIAVTVYVPRGLWYDYYTFNSYFSIGKYYTFPAPIDKIPLLIRAGSI
LPAQEPGVTTTESRKNNFELIVTLNETKNAIGELYWDDGDSLDSIKKKEYLWLSFIANQS
SLLNMEMDKGSFNEEVILGTVQIFGLRPVITVFLNNNEIEFSFNLSTSSLHITGLQVDMR
QPFIFNWIFEDIFNNNYT
NT seq 3117 nt NT seq  +upstreamnt  +downstreamnt
atggctgatgtagaagcaagtgggcaggatgtttctgaaaaatcaggatattacagtgca
accaaagatcgtccaaacaaaattatggagaaatttaataccgttgtggttaaaacatta
aacaataaattctatgagccatcaatgaaaaaatatgaaaaagaagagttgaatcttgat
aaacgtcacaatgtaaaacgtataataataacgttattcttaggtctcatcacggcttta
ttgttgtgtcatctcggtcttccattattatatgcgattataaatccattacgtactgtg
aatagttacaatgcagaagtggaatttatgattgatataaataatgatagcattgaggag
acaagatatcagcatatattagtggatactcctgatatatacatcgaacaagaaacatat
gatcgtaaaatagtgcctttgaaagaagaaagtaatttatctgaagaaaacacagctttt
aacaatgctcaacagtgcagcaatgttcctgaaatattacgctttgattgtcatccagag
aatggagcatcgcaactttcttgcataaatagaggatgttgttggaatcctcgtaagaat
aataaaaatgagaaagatgtatcgctagatattccttactgtttctatcctgatggatgg
aatctgtataaatatattaaccgcagtcaggatggaagtaatttcttgggttttctcagt
caagaaaaaaaatctgtgtacaagaacaatgtgccccttgtcaagatagaagccacaagc
ataaacagctcaattctgcgtgtgaagatatatgatcccattaaaacgcgatatgaacca
ccatggccaattagatcggatccgaaaccatttttatatcaagttgttgacacgaaatat
caatttaatactgatgatataaaacctggctttaaagtcaatagaatcagtgatggcaca
acactatttaattccattgggattggaggtttcatatttgctgaccaatttctacaaata
agctcattgttaccaacaagtaacatttatggtattggcgggcatcaatcgaacttaaaa
ttaaatactaattggcaaattttcactctatttaatttagatcaagcgccaatggaaaat
gcaaatttgtatggatctcatccattttatattgttatggaggaatctggaatggctcat
ggagttttatttctaaacagtaatgctatggatgtgatactgcagcctacaccggctata
acgtttagaacaatcggtggtatttttgatatttactttttcctgggaccgactccagcc
gatgtagtgaaacaatattctgaaattgtaggcaaaccatttatgccgccttattggtcg
cttggtttccatttatgcagatatggatatgaatcgttggaaaatactaaagcagtatgg
aacaggacgagaacagctggaatcccatttgatactcaatggaatgatctggattatatg
gacaaaaataatgattttacatataataaagagaaatttaaagatttacctaaatttgta
gaagaaattcactcgataggaatgcattatatacccttaattgatgctggcatatctgct
ttcgaagataatggttcttatctgccttacgtcgaaggaataaaacaagacatattcgta
aaagatggtgaatccgacaaacctttcatcggtaaagtttggaattttttttccacggta
tggcctgatttcacaaatcctaaaactatgatctattatgcaaatatgatgggagatatg
cacaataattttacgtacgatggtgcatggattgatatgaacgagccagccaatttttac
aatggtaataagaatggttgtacacataataatttagattatcccgaatatattcccaat
gttgttggcggtttgctcgctacgaaaactttttgcatgaatgcgaaacattatttgggc
actcattataatcttcacaatacttatggaacgagtcaagcgattaccacaaattatgct
cttaggaaaattagactaaagagaccatttataatatcgcgttcaacatggataggacat
ggtcattatgcgggtcattggacgggtgacgtttattcatcatggcatgatttaaagatg
agtattccagctattttgtcattcaatttttaccaaattccaatggtgggcgcagatatt
tgcggttttaacggaaacacaactattgcattgtgcaatcgttggatgcaacttggtgct
ttttatccattttctcgaaatcataattccgatgatacaattgagcaagatccagttgct
atgggcgatttggttgtacaatcgtcaaaaaattctctcaaaatacgttatcgattttta
ccatatttgtacaccttattcttcagagcacataaattcggagaaactgtagtacggcca
cttttctttgaatttaccgaagatcggcaaacttacgatattgataaacaatttctttgg
ggaaattcgcttatgatcaatccagttctcgaagagaacaaaattgcggtaactgtttat
gtaccacgaggtttgtggtatgattattataccttcaattcctatttctccattggaaaa
tattataccttccctgcaccaattgacaaaataccattattgattcgtgcaggttcgatt
cttccagcacaggaaccgggtgtaacaacgacagagagcagaaaaaacaattttgaatta
atagtaacattgaatgaaactaaaaatgctataggagaattgtattgggacgatggtgat
agcttagattccataaaaaagaaagaatatttgtggctgtctttcattgcaaatcaatca
agtttattgaatatggaaatggataaaggttcttttaatgaagaggtaatactgggaaca
gtacagatttttggattacgaccagtcatcacagtgttcctaaataataatgagatagaa
ttttcatttaatctttccacatcgagcttacatattactggtttgcaagtggatatgaga
caaccatttatatttaactggatatttgaagatattttcaataataattatacataa

DBGET integrated database retrieval system