KEGG   Acromyrmex echinatior (Panamanian leafcutter ant): 105145346Help
Entry
105145346         CDS       T03917                                 

Definition
(RefSeq) peroxisomal acyl-coenzyme A oxidase 3
  KO
K00232  acyl-CoA oxidase [EC:1.3.3.6]
Organism
aec  Acromyrmex echinatior (Panamanian leafcutter ant)
Pathway
aec00071  Fatty acid degradation
aec00410  beta-Alanine metabolism
aec00592  alpha-Linolenic acid metabolism
aec00640  Propanoate metabolism
aec01040  Biosynthesis of unsaturated fatty acids
aec01100  Metabolic pathways
aec01200  Carbon metabolism
aec01212  Fatty acid metabolism
aec04146  Peroxisome
Module
aec_M00013  Malonate semialdehyde pathway, propanoyl-CoA => acetyl-CoA
aec_M00087  beta-Oxidation
aec_M00861  beta-Oxidation, peroxisome, VLCFA
Brite
KEGG Orthology (KO) [BR:aec00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00640 Propanoate metabolism
    105145346
  09103 Lipid metabolism
   00071 Fatty acid degradation
    105145346
   00592 alpha-Linolenic acid metabolism
    105145346
   01040 Biosynthesis of unsaturated fatty acids
    105145346
  09106 Metabolism of other amino acids
   00410 beta-Alanine metabolism
    105145346
 09140 Cellular Processes
  09141 Transport and catabolism
   04146 Peroxisome
    105145346
Enzymes [BR:aec01000]
 1. Oxidoreductases
  1.3  Acting on the CH-CH group of donors
   1.3.3  With oxygen as acceptor
    1.3.3.6  acyl-CoA oxidase
     105145346
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: ACOX Acyl-CoA_dh_M Acyl-CoA_dh_1
Motif
Other DBs
NCBI-GeneID: 105145346
NCBI-ProteinID: XP_011053135
LinkDB All DBs
Position
Unknown
AA seq 688 aa AA seqDB search
MRVRLKKQLFVREGDVEYLSFTRGKRTMSTANNLIKDLPSGPLDVYRKRATFDWKSFKLS
LEGEDSVRMQLKLWQLIKTHPVFQKSTYPKSLDEIRKRVNSQIQVLCENNIDPISDINSV
LYLFQYDGSISIRISITRGMVPGAIFALGTNQHHQLLAEFSTGNYIGWFVLTEIAHGTNA
KGIQTKATYDVATKSFILHTSDFEAAKCWAGNLGKCATHALIFAQLITSDGVNRGLHVFI
VPIRDLQTHLPFPGVTVGDMGEKIGLNGIDNGFIMFDNYSIPRNCLLNRTADVTEDGKYV
LALKNERKRYGSSLGALSGGRVTITGICYHYMVIALTIAIRYCAVRKQFGPTEDNELPVI
EYQTQQWRIIPHLAATYAVKIFSSALRKDFDELQMNRLSKDEDSTADLGMEIHALSSATK
PLCSWISRDMIQDCRESCGGHGYLKMSRLGEIRADNDANCTYEGENNVLIQQASNWLLNQ
WANVIKGQAVPSPLNSADFLVNAEQILNNKFNQTTVEDVLKPKNLLLIFKWLVCYYLKKT
YQRMKEFQSDGMSDFDVKNNIQTFLARTLSLVYAEHAVMLYFNRCLQDPKWKTNEREVLT
KLCSLFGAITLEKRLGDLYSGGYASPNSNIDNFLREGIIMLCRDLVDNAVALVDVLAPPD
FILNSALGMSDGEVYKHIKEWIFKDKEN
NT seq 2064 nt NT seq  +upstreamnt  +downstreamnt
atgagagtgcggctaaaaaaacaattattcgtcagagaaggggatgtcgagtatttaagt
ttcacgagaggaaaacgcacgatgtctactgctaataacttgataaaggatttgccaagt
ggaccattagatgtttataggaaacgagcgacattcgactggaagtcgtttaaattatct
ttagagggagaagattccgtacgaatgcagttaaaattatggcaactcatcaaaacccat
ccagtgtttcaaaagtcgacgtacccgaagagtttggatgaaattcgaaaacgcgtcaat
agccagatacaagttctttgcgagaataatatagatccaataagcgacattaacagtgtt
ctttatctttttcaatacgatggatcgatatcgatacgaataagtatcacacgaggtatg
gtaccaggtgctatatttgcactgggtactaatcaacatcatcagcttctagctgaattt
agcactggaaattatattggctggtttgtgctgactgagattgctcatggaactaatgca
aaaggtatacaaactaaagcaacatatgatgtagcaacaaaaagttttatccttcatact
tccgactttgaagctgcaaaatgttgggcaggtaatctaggaaaatgcgcaacgcatgct
ctcatatttgcgcaactaattacatcggacggagtaaaccgtggcttgcacgtttttatt
gtgccaattcgcgatctgcaaactcatttaccttttcccggtgttaccgttggtgatatg
ggtgaaaagataggccttaatggaatagacaatggattcataatgtttgacaattattct
ataccgcgtaattgtttgttaaatcgcaccgcagatgtcaccgaagatggaaagtatgtc
cttgctctaaagaatgaacgaaaaagatatggttcgtcgttgggtgcactgtcaggaggc
cgtgtcacgattactggaatatgttaccactatatggtcattgcattaactattgctata
cgttattgtgcagttaggaaacaatttggtcctaccgaggataatgaattgccagttata
gaatatcaaacgcaacaatggcgaatcattcctcatttagctgcaacgtacgcagtaaaa
atattttcatcagcattgagaaaagattttgatgaacttcaaatgaaccgtttgagtaag
gatgaagactcgaccgccgatctaggaatggagatacacgcgttatctagtgcaacaaaa
ccattatgttcatggatttctcgtgacatgattcaggattgcagagaatcttgcggtgga
cacggatacttaaaaatgtctcgtttgggtgaaataagagctgacaacgatgcaaactgt
acatatgagggtgaaaataatgtacttattcagcaagcaagtaattggttattaaatcag
tgggctaatgtgattaaaggacaagccgtaccatctccacttaattccgcagattttctt
gtaaatgcagaacaaatacttaacaacaaatttaatcaaactacagtggaagatgtactg
aaacccaaaaatttgctcctaatttttaaatggttggtttgttattatttgaaaaagaca
tatcaacgtatgaaggaattccaatcagacggaatgtctgattttgatgtaaaaaacaat
atccaaacgtttctagcacgaaccttatctctcgtatatgctgaacatgccgtaatgcta
tactttaacagatgtttacaagatccgaaatggaaaacaaacgaaagagaagtattaaca
aaattgtgttccttattcggagctataacattggagaaaagattgggagatttgtacagt
ggtggttatgcttctcctaatagtaatatagataattttttgcgggaaggaattataatg
ttgtgcagagacttagtcgataatgctgttgcactagtcgacgtattggcaccgcctgac
tttattcttaattctgctctaggaatgtccgatggcgaggtatataaacacataaaagaa
tggatatttaaagacaaagagaat

DBGET integrated database retrieval system