KEGG   Acromyrmex echinatior (Panamanian leafcutter ant): 105146498Help
Entry
105146498         CDS       T03917                                 

Definition
(RefSeq) hexokinase type 2-like isoform X1
  KO
K00844  hexokinase [EC:2.7.1.1]
Organism
aec  Acromyrmex echinatior (Panamanian leafcutter ant)
Pathway
aec00010  Glycolysis / Gluconeogenesis
aec00051  Fructose and mannose metabolism
aec00052  Galactose metabolism
aec00500  Starch and sucrose metabolism
aec00520  Amino sugar and nucleotide sugar metabolism
aec01100  Metabolic pathways
aec01200  Carbon metabolism
Module
aec_M00001  Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
aec_M00549  Nucleotide sugar biosynthesis, glucose => UDP-glucose
Brite
KEGG Orthology (KO) [BR:aec00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    105146498
   00051 Fructose and mannose metabolism
    105146498
   00052 Galactose metabolism
    105146498
   00500 Starch and sucrose metabolism
    105146498
   00520 Amino sugar and nucleotide sugar metabolism
    105146498
  Biosynthesis of other secondary metabolites
   00524 Neomycin, kanamycin and gentamicin biosynthesis
    105146498
Enzymes [BR:aec01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.1  hexokinase
     105146498
Membrane trafficking [BR:aec04131]
 Autophagy
  Mitophagy
   Other mitophagy associated  proteins
    105146498
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Hexokinase_2 Hexokinase_1 PTN_MK_N
Motif
Other DBs
NCBI-GeneID: 105146498
NCBI-ProteinID: XP_011055101
LinkDB All DBs
Position
Unknown
AA seq 487 aa AA seqDB search
MKTKNRSLFSRICKCYSKKETLDIRRYSRRDSETSYRDPEMYLNPTDEIRDACKDLVLSN
DQLRLVMQKLTDEINKGLSKETHDDAIVKCFTTYVQDLPNGTEKGNFLALDLGGTNFRVL
LITLDRQNFDMKSKIYAIPQSLMLGTGTQLFDHIAQCLALFVKDLNLQNEVLPLGFTFSF
PLTQHGLTEGHLVRWTKGFNCSGVIGEDVVALLEDAISRRKVKIDVCAILNDTTGTLMSC
AWKNRNCRIGLIVGTGSNACYVEKTKNVQCAIPGNYSTSKSDMLINTEWGAFGEQDVLDF
VITEFDRAIDENSINPNKQLFEKMISGMYMGELTRLVLEKLVNAGFLFGGKCPNDLRKRG
KFFTKYVSEIENDPKGRYTNCREVLAELGMRNVSDQDCENVRYVCSVVSRRAAHLVSAGI
AALLNKIGENNVTVGIDGSVYRFHPHFHDLMTVKINELQKYKFDLMLSEDGSGRGAALVA
AVASQRR
NT seq 1464 nt NT seq  +upstreamnt  +downstreamnt
atgaagacaaaaaacagatcgttattcagcagaatatgcaagtgttacagcaagaaagaa
acattagatatacggagatattcgagaagggattctgaaacgtcttatcgggatccagaa
atgtatttaaatccgacagacgagatacgagatgcctgcaaggacctcgtcctatcaaat
gaccagctccggctggtcatgcagaagctcaccgacgagatcaacaagggtctgtcgaag
gaaactcatgacgatgcgatcgtcaaatgcttcaccacttatgtgcaagatttgccgaat
ggcacagaaaagggcaacttcctagcgttggatctgggcggtacgaattttagagtgttg
ctaatcacattggaccgtcagaatttcgatatgaaaagcaagatctatgcgataccccag
agtttgatgctgggaaccggtactcagctgtttgatcacattgcacagtgtttggcgtta
ttcgtaaaggacctgaacttgcagaacgaggtactaccattaggctttaccttcagtttt
cctctgacccaacacggattgacagaaggccacttggtgaggtggaccaagggcttcaat
tgtagcggcgtaatcggtgaagatgtcgttgcccttctcgaagacgcaattagtagaaga
aaagttaaaattgacgtatgtgcgatcttaaatgacaccaccggcactttaatgtcatgt
gcttggaaaaatcgaaactgtcgcatcggtttaatcgtcggtactggaagcaatgcctgc
tacgtcgaaaaaacaaaaaacgtacaatgtgcgattccaggcaactatagcacaagcaag
tccgatatgctcataaacacagaatggggcgcatttggtgaacaagatgtgctagatttt
gtgataaccgaatttgatcgtgccatagatgaaaattctatcaatcctaataagcagctg
tttgagaaaatgatctcgggcatgtatatgggtgaactaacaagactggttcttgagaag
ttggtgaacgctggctttcttttcggcggtaaatgtcccaatgatctcagaaaacgcggc
aaatttttcacgaaatacgtctccgaaattgaaaacgatcctaaaggtagatatacgaat
tgccgggaagtattagccgagctaggaatgcggaatgtgagtgatcaagattgtgaaaat
gtgagatatgtgtgttcggtggtatcgagaagagctgcgcatttggtgagcgcgggaata
gcagcgttgctaaacaaaataggggagaataatgtcacagtgggcattgatggatcggta
taccgattccatccacacttccacgatctcatgacagtgaaaatcaacgaacttcagaaa
tacaagtttgacttgatgctctcggaggacggtagcggccgcggcgctgctctagtcgct
gcagtggcgtcgcagagacggtga

DBGET integrated database retrieval system