KEGG   Acromyrmex echinatior (Panamanian leafcutter ant): 105146699Help
Entry
105146699         CDS       T03917                                 

Definition
(RefSeq) angiotensin-converting enzyme-like
  KO
K01283  peptidyl-dipeptidase A [EC:3.4.15.1]
Organism
aec  Acromyrmex echinatior (Panamanian leafcutter ant)
Brite
Enzymes [BR:aec01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.15  Peptidyl-dipeptidases
    3.4.15.1  peptidyl-dipeptidase A
     105146699
Peptidases [BR:aec01002]
 Metallo Peptidases
  Family M2
   105146699
Exosome [BR:aec04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   105146699
CD molecules [BR:aec04090]
 Proteins
  105146699
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Peptidase_M2
Motif
Other DBs
NCBI-GeneID: 105146699
NCBI-ProteinID: XP_011055425
LinkDB All DBs
Position
Unknown
AA seq 651 aa AA seqDB search
MLRLILVAVVVTLVIAKPTTEDAVDISTNHETTDDLLKSAHELLNRIDAEYAKWNNKQSV
TAWNYASNLTNENLAEKLKWSAEGANVTKHIIQIVNDFPWRDLKNESMKRQFKKLSILGV
AALPEQSYNEFEMTVSKMENIYSTAKICDYYNKSKCDLALEPEIIEISKNSHDPEELKHI
WVEWRKVSGEKVKSLYSTYVELANTVATLNNFSDYAAFWMKDYEADDFPEQIETQWQQLK
PLYLQLHAYVRRELRKKYGEDIVSKDGPIPAHLLGNPWAQTWNIANFTVPFSGKQLPDVS
AALVEQDYNATSMFRLAENFFISINLTAMPDTFWEKSILTKKDGVDMICHASAWDFYDGE
DFRIKQCTRVNMEDLLTAHHEMGHIEYYLQYKNQPVVFKEGANPGFHEAVGDVISLSVST
PSHLKKIGLLTDDSTDREAFLNHLYMKSLDKIVFLPFAYMMDRWRWNVFQGKVTPDNYNC
NWWTLAEEYQGIEPPVDRSEEDFDPGSKYHIIAGVEYIRYFVSFVIQFQFHKALCIEAKQ
YDPSNPNAKPLSQCDIYDNKDAGNLLKSMLELGSSKPWQDAMEKISGQRQMDAAGLLEYF
KPLTDWLTEENKKTNEYIGWKPSKKQCVQTREELVNITDIEPLTYSSLTKY
NT seq 1956 nt NT seq  +upstreamnt  +downstreamnt
atgctgcgcctaatattggtagcagtagttgtaactctagtgatagccaaaccaacgacc
gaagacgcagtagatatcagcacaaatcacgaaactaccgacgatcttctgaaaagcgct
catgaactcttgaatcgaatcgacgcagagtatgcaaaatggaataataagcagagtgtc
accgcatggaattacgcatcgaatctaacaaatgagaatctggcagaaaagttgaaatgg
tcagcagagggagcgaacgttaccaaacatattattcaaatagtgaatgacttcccttgg
agagacttgaaaaatgagtctatgaagagacagttcaaaaagctcagtatactcggtgtc
gccgctctccctgaacaaagttataatgaatttgagatgacagtgagtaaaatggagaat
atctatagcaccgcaaagatctgcgattattataacaagagcaagtgtgatcttgcgctt
gagccagaaattattgagatatcaaagaatagtcacgatcctgaggagctaaagcatatt
tgggtggagtggaggaaagtatcaggcgagaaagtcaaatctctgtattccacatatgtt
gagctagccaatactgtggcgacactcaacaacttctctgactatgcagcattttggatg
aaggattacgaggctgatgattttcctgaacaaatcgagactcaatggcaacaactgaag
ccactgtatttacaactgcatgcttacgtacggcgcgagctcaggaagaaatacggcgaa
gacatcgtctccaaagacggcccgatcccagcgcatctattgggcaatccctgggctcag
acttggaatattgcaaacttcaccgtaccattctcgggcaaacaactgccggatgttagt
gctgctttggtagaacaagattacaatgcgacaagcatgttccgtctcgctgagaacttc
ttcatatcaattaacttgactgctatgccggacacattctgggaaaaatcgattctgaca
aagaaggatggtgtagacatgatctgccatgcgagcgcatgggacttctacgatggcgaa
gatttcaggatcaagcaatgtacgcgcgttaacatggaagacttgctaacagcgcatcat
gagatgggtcacatcgagtattacttgcagtacaagaaccaacctgtagttttcaaggag
ggcgcgaatccaggtttccacgaggcagttggtgatgttatttctctcagcgtatctacc
cccagtcatctcaagaagatcggtctactgacagatgattcgactgatcgggaggcattc
cttaatcacctctatatgaagagtcttgacaagattgtcttcctgccattcgcttacatg
atggaccgatggcgttggaacgtattccagggaaaagtcacgccagacaattataattgc
aactggtggacactcgccgaggaataccagggcatcgaacctcccgtagataggtcggaa
gaagatttcgatcctggctcaaagtatcatataattgcgggcgtcgagtatataagatac
tttgtaagctttgtgatacagtttcagttccacaaggcattgtgcatcgaggcgaagcaa
tatgatccgagcaatccaaatgctaagccgttgagtcaatgtgacatttacgataataag
gacgccggaaatctgctaaaatctatgctggagttgggttcttcgaaaccgtggcaagac
gcaatggagaagatctctggtcaaaggcaaatggatgcagctggacttttggaatatttt
aagcctttgactgattggttgactgaagaaaataagaaaactaatgaatacattggatgg
aaacccagtaaaaaacaatgtgtacagacgagagaagagcttgtgaatattacagatatt
gaacctttaacatattcttcactaacaaaatactaa

DBGET integrated database retrieval system