KEGG   Acromyrmex echinatior (Panamanian leafcutter ant): 105148010Help
Entry
105148010         CDS       T03917                                 

Definition
(RefSeq) ras-like GTP-binding protein Rho1 isoform X1
  KO
K04513  Ras homolog gene family, member A
Organism
aec  Acromyrmex echinatior (Panamanian leafcutter ant)
Pathway
aec04144  Endocytosis
aec04150  mTOR signaling pathway
aec04310  Wnt signaling pathway
aec04350  TGF-beta signaling pathway
Brite
KEGG Orthology (KO) [BR:aec00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04310 Wnt signaling pathway
    105148010
   04350 TGF-beta signaling pathway
    105148010
   04150 mTOR signaling pathway
    105148010
 09140 Cellular Processes
  09141 Transport and catabolism
   04144 Endocytosis
    105148010
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:aec04131]
    105148010
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:aec04147]
    105148010
   04031 GTP-binding proteins [BR:aec04031]
    105148010
Membrane trafficking [BR:aec04131]
 Endocytosis
  Lipid raft mediated endocytosis
   RhoA-dependent endocytosis
    105148010
Exosome [BR:aec04147]
 Exosomal proteins
  Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)
   105148010
  Exosomal proteins of other body fluids (saliva and urine)
   105148010
  Exosomal proteins of colorectal cancer cells
   105148010
  Exosomal proteins of bladder cancer cells
   105148010
GTP-binding proteins [BR:aec04031]
 Small (monomeric) G-proteins
  Rho Family
   RhoA/B/C [OT]
    105148010
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Ras Roc Arf GTP_EFTU SRPRB Gtr1_RagA
Motif
Other DBs
NCBI-GeneID: 105148010
NCBI-ProteinID: XP_011057739
LinkDB All DBs
Position
Unknown
AA seq 202 aa AA seqDB search
MFRRNTRKGFMAAIRKKLVIVGDGACGKTCLLIVFSKDQFPEVYVPTVFENYVADIEVDG
KQVELALWDTAGQEDYDRLRPLSYPDTDVILMCFSIDSPDSLENIPEKWTPEVKHFCPNV
PIILVGNKKDLRNDPNTIKELGKMKQEPVKPEEGRAMAEKINAFAYLECSAKSKEGVREV
FETATRAALQVKKKKRGRCRLL
NT seq 609 nt NT seq  +upstreamnt  +downstreamnt
atgtttcgaagaaatacacgaaagggattcatggcagccattagaaagaagttggttatt
gtaggcgacggtgcttgtggtaaaacatgtcttctaatagtgttcagcaaagaccagttt
cctgaggtgtatgtacccacagtattcgagaactatgtcgccgatatcgaggtggatggc
aaacaggtggaactggctctttgggacacagctggacaagaagattacgacaggttgcgt
ccgttgtcgtatccggacacggatgttatcctaatgtgcttctccatcgatagtcccgat
tccttggagaacattcccgagaagtggacaccagaggtgaagcacttctgcccaaacgtg
cccattatccttgttggaaacaaaaaagacttgcgcaatgatcctaacaccatcaaggaa
cttggcaagatgaaacaagagccagttaagcctgaggagggtagggccatggcggagaaa
atcaatgctttcgcctaccttgagtgttctgccaaaagcaaggaaggtgtaagggaagtt
ttcgaaacggcaactcgagctgcattacaagtaaagaagaagaagaggggaagatgtagg
cttctttaa

DBGET integrated database retrieval system