KEGG   Acromyrmex echinatior (Panamanian leafcutter ant): 105148421Help
Entry
105148421         CDS       T03917                                 

Definition
(RefSeq) DNA ligase 1 isoform X1
  KO
K10747  DNA ligase 1 [EC:6.5.1.1 6.5.1.6 6.5.1.7]
Organism
aec  Acromyrmex echinatior (Panamanian leafcutter ant)
Pathway
aec03030  DNA replication
aec03410  Base excision repair
aec03420  Nucleotide excision repair
aec03430  Mismatch repair
Brite
KEGG Orthology (KO) [BR:aec00001]
 Genetic Information Processing
  Replication and repair
   03030 DNA replication
    105148421
   03410 Base excision repair
    105148421
   03420 Nucleotide excision repair
    105148421
   03430 Mismatch repair
    105148421
Enzymes [BR:aec01000]
 6. Ligases
  6.5  Forming phosphoric-ester bonds
   6.5.1  Ligases that form phosphoric-ester bonds (only sub-subclass identified to date)
    6.5.1.1  DNA ligase (ATP)
     105148421
    6.5.1.6  DNA ligase (ATP or NAD+)
     105148421
    6.5.1.7  DNA ligase (ATP, ADP or GTP)
     105148421
DNA replication proteins [BR:aec03032]
 Eukaryotic Type
  DNA Replication Elongation Factors
   Other elongation factors
    105148421
 Prokaryotic Type
   Elongation factors (archaeal)
    Other elongation factors
     105148421
DNA repair and recombination proteins [BR:aec03400]
 Eukaryotic Type
  SSBR (single strand breaks repair)
   BER (base exicision repair)
    Long Patch-BER factors
     105148421
   NER (nucleotide excision repair)
    Other NER factors
     105148421
   MMR (mismatch exicision repair)
    Other MMR factors
     105148421
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: DNA_ligase_A_M DNA_ligase_A_N DNA_ligase_A_C mRNA_cap_enzyme
Motif
Other DBs
NCBI-GeneID: 105148421
NCBI-ProteinID: XP_011058436
LinkDB All DBs
Position
Unknown
AA seq 980 aa AA seqDB search
MLKILTTCSRLSSLALPIRRLELAVAAHTRFVVFNWIHTTNSHNLSDKQNQNATENGKRK
RDSSNSSSSPSNNVKRTKSKTVSKTPSPSVKPRKLGATPKIKPSKLSPGASKKAEKRQLK
DTPGKKKKKEEAENINDVEEKNNHIENGITEEKNKKEESTFSTKKLKSNEVEKVKKSAKK
KWSKIVQLVDSSDDETHLPLPESPKKSETDNEEKKTESVDKSSNINKNVSDNASDNDANE
SASNNEEKNLNPKKESTPENSETPSKNESSKKESTPEKSQTPSKDENPKKEPTPNKKAKK
VPNFFMSKQKGDAKGDKVNNGKSANQSYNPSASVYHPIDDACWKRGDKTPYSAFARTLEI
IEETSARLKIIEILSNYFRSVIVLSPEDLLPSVYLCLNQLAPAYEGVEFGIADTNLMKAI
AQCTGRTLAQIRADVQEVGDLGIIAENSKSNQRTMFQPAPLTVPNVYSRLMEIAQMTGHA
SLSKKLDKIQTLFVACRNTEARYLVRLLAGKLRIGLAEQSVLQALALACAMTPPEQKYPP
EILNASKKISSDRFKEKYDEIALILKTTYCECPNYNLIIPVLLEDGINTLPSKCKLTPGI
PLKPMLAHPTKGVQEVLTRFEGLKFTCEWKYDGERAQIHVADNGQIKIYSRNQEDNTTKY
PDIIKRFKNSRGDEVKNCILDCEAVAWDNEKKQILPFQILSTRKRKDANEEDIKVQVCVF
MFDLLYLNDEPLVKEPFVKRRELLKQHFKEVEGEWKFANSLDASTMEEVEVFLDESVKGN
CEGLMVKTLEKEATYEIAKRSRNWLKLKKDYLDGVGDTLDVVVIGGYIGKGKRTGTYGGF
LLACYDLENEEYQSICKIGTGFKEDDLENHTKFFKDHIVPQVKSYYRFDSSHEPDHWFEP
VQVWEIKCADLSLSPVHRAAIGIVDPEKGISLRFPRFIRIREDKTCEQATSAQDVANMYN
NQEQIKNKTSVSKATEEDFY
NT seq 2943 nt NT seq  +upstreamnt  +downstreamnt
atgctaaaaatcctcactacatgctcgcgcttgagctcgctggctttgccgattcgacgg
ctagagctcgcagtcgcagctcacactcgatttgttgtttttaattggatacatacaacc
aacagccacaacttgtcagacaaacaaaatcagaatgcaacggagaatggcaaacggaaa
agagatagcagcaacagttccagttcaccttcgaataatgttaaacgtacaaagtcaaag
acggtttccaagacaccttcgccaagtgttaagcctcgcaaactaggagctaccccaaaa
attaagcctagtaagctttcccctggagcatcaaaaaaggcagaaaaaaggcaattgaaa
gatacccctggtaaaaagaaaaagaaggaagaggctgaaaatataaatgatgttgaagag
aagaataatcatatagaaaacggtataactgaagagaaaaataaaaaagaagaatctaca
ttttcaacgaagaaattaaagtctaatgaggtagaaaaagtaaagaagtctgcgaaaaag
aaatggtccaagatagtgcaactggtagattctagtgatgatgagactcacctaccttta
cctgaaagtccaaaaaaatcagagactgacaatgaggagaagaagactgaaagtgtagac
aagtccagcaacataaataaaaatgtttctgataacgcttctgataatgacgcaaacgaa
agtgcttcaaacaatgaagagaaaaatctaaatccgaagaaagagtctacacctgagaac
tcggagactccctctaagaatgaaagttcaaagaaagaatctacacccgagaaatcccag
actccctctaaggatgaaaatccgaagaaagagcctactcctaacaaaaaggctaagaaa
gtgcccaacttttttatgtctaagcaaaagggcgacgcgaaaggtgacaaagtgaacaat
ggaaaaagtgccaaccaatcttacaatcccagcgcgtctgtctatcatccgatagacgat
gcgtgctggaaacgaggggacaaaactccatatagcgcattcgcgcgcaccttggaaatc
atcgaagaaactagtgcaagattaaagataatagagatactatcaaattacttccggtct
gtcatagttctgagccccgaggatcttttgccgagcgtttatctgtgccttaatcaatta
gcgccagcgtatgaaggagttgagtttggaatcgctgatacgaatctgatgaaggcgata
gcgcaatgtactgggagaacactggcgcaaattagagctgatgtccaggaggttggcgat
ttgggaattatagcggaaaatagtaaatctaatcagagaactatgtttcaaccggcgcca
ttgacagttcccaatgtatactccagattgatggaaattgctcagatgacaggacatgcg
tctctatcgaaaaagttggataaaattcagacgctgtttgtagcgtgccgaaatacagaa
gcaagatatttagttagattgttagctgggaagcttcgcattggattggcggaacaatct
gttttacaagcattggctttagcttgcgcaatgacacctccggaacaaaagtatccacca
gaaattctaaatgcaagcaaaaagatatcgagtgatcgtttcaaagagaaatatgatgaa
atagcgcttatattgaaaacaacgtattgtgaatgtccgaattataatcttataattcct
gttttgctggaagatggaattaataccttgccgagcaagtgcaaacttactcctggaata
cccttgaaacctatgttagcgcatcctactaaaggtgttcaagaagttctaacgcgattt
gagggtttgaaatttacttgtgaatggaaatatgacggggaaagagctcagatacatgtt
gcggacaatggtcaaataaaaatatacagtagaaatcaggaggacaatactaccaagtat
ccagatatcattaagcgattcaagaatagtcgcggtgatgaagtgaagaattgtatactg
gattgtgaggcggtcgcttgggataatgagaagaaacaaattttaccgttccaaatactc
agtacaagaaagcgaaaggatgctaatgaggaggacattaaagtacaagtatgtgtgttt
atgtttgatctgttatatctaaatgacgagccattagtgaaggaaccgttcgtgaaacgt
cgtgagttgttgaaacagcatttcaaggaagtggaaggcgaatggaaattcgctaatagt
ttagatgcctcgacgatggaagaggtggaagtttttttggacgaatctgtgaagggaaat
tgcgagggtttgatggtaaagacgttggaaaaggaggcgacctatgagatcgcgaagcga
tcgagaaactggctgaagttaaaaaaggactacttagatggcgtcggcgatacgctcgac
gtagttgtaatcggtggttacatcggcaaaggaaagaggaccggcacttatggtggtttc
ctcttagcttgttatgatctggaaaatgaagagtaccagagcatttgtaagatcggtacg
ggattcaaagaagatgatctcgaaaatcataccaaattcttcaaggatcacatagtacca
caggtcaaatcgtattatcgcttcgatagcagccatgaaccggatcactggtttgaacca
gttcaagtttgggagatcaagtgtgccgatctttccctttcgcctgtacacagagcggct
atcggaatagttgatccggaaaagggaatatctttaaggttcccacgatttatcaggatc
cgcgaggataagacctgcgagcaggccacttccgctcaagacgtggcaaatatgtacaat
aatcaagaacagataaaaaataaaacttcagtatcgaaagccacggaggaagatttctat
taa

DBGET integrated database retrieval system