KEGG   Acromyrmex echinatior (Panamanian leafcutter ant): 105148513Help
Entry
105148513         CDS       T03917                                 

Definition
(RefSeq) putative protein kinase C delta type homolog
Organism
aec  Acromyrmex echinatior (Panamanian leafcutter ant)
SSDB OrthologParalogGFIT
Motif
Pfam: Pkinase Pkinase_Tyr Pkinase_C FTA2 Haspin_kinase APH
Motif
Other DBs
NCBI-GeneID: 105148513
NCBI-ProteinID: XP_011058603
LinkDB All DBs
Position
Unknown
AA seq 394 aa AA seqDB search
MACHKKCEKLTGNLCGLNQKLVAEALQALKRTPSQSSDNQRNSDSLDHFSSGRITPPATN
LPRFKKYTIMDFNFLKVLGKGSFGKVLLAELRGTDCVYAVKCLKKDVVLEDDDVECTLIE
RKVLTLATRHPYLCHLFCTFQTDSHLFFVMEYLNGGDLMFHIQKSGRFSEVRARFYAAEI
WSGLNFLHKKGIVYRDLKLDNVLLDFEGHIRIADFGMCKLQIFLDRTADTFCGTPDYMAP
EIIKGLKYNQAVDWWSYGVLLYEMLTGQSPFSGCDEDELFWSICNERPFIPRYLSQEATE
ILIYLLEKDSGKRLPAHEIAVHAFFQHLPWDRLERRQLEPPFKPALDHTLDTKYFDTAFT
TERPRLTPVPEQILTSMDQGVFRGFSYTNPNATD
NT seq 1185 nt NT seq  +upstreamnt  +downstreamnt
atggcttgccataagaaatgcgaaaaactgacagggaatctatgtggattgaatcaaaaa
ctagtcgctgaagcattgcaagctttgaagagaactccttcacagtcgtcagataatcaa
cgaaactcagattctttggatcatttttcgagtggccgaataacaccaccggcgacgaat
ttgcccagattcaagaaatatactataatggattttaattttctcaaagtcttgggtaaa
ggcagcttcggtaaagtattgctggcggaattacgtggcacggactgtgtgtacgcagtt
aaatgtttaaagaaagatgtggttctcgaggatgacgatgtcgaatgcacattaattgaa
aggaaggtcctcacgctggcgactagacatccgtatctttgtcacttgttttgcactttc
cagactgattcgcatctcttttttgttatggaatatctcaatggaggtgatctaatgttt
cacatacagaagtctggccgattttctgaggtgcgtgcacgtttttatgctgccgagatc
tggtctggattgaattttctacataagaagggtattgtttatcgggatctcaaacttgac
aatgtgctactcgatttcgagggtcatattagaatcgcggactttggcatgtgtaaactt
cagatcttcttagatagaacggccgatacgttctgtggtacgccagattacatggcgcca
gagataataaaaggacttaagtataatcaagctgtggattggtggtcgtacggtgttctg
ttgtatgaaatgctcactggtcaatcaccattttctggatgcgatgaggacgagttgttt
tggagcatttgtaatgaacggccgtttatacctcgatatttaagtcaagaagctaccgaa
atacttatctatttgttagagaaagattctggaaagaggctacctgctcacgaaatcgct
gtgcatgctttttttcagcatttgccttgggatcgattagaaagaaggcaattagaacca
ccgtttaagcccgcacttgatcatactttggatacgaaatactttgatacagcattcacg
actgaacgtccaaggcttacgccagtgcctgagcagattttgacttcgatggatcaaggt
gttttccgcggattctcttatacaaatccgaacgcgaccgattga

DBGET integrated database retrieval system