KEGG   Acromyrmex echinatior (Panamanian leafcutter ant): 105150106
Entry
105150106         CDS       T03917                                 

Definition
(RefSeq) uncharacterized protein LOC105150106
  KO
K16679  wengen
Organism
aec  Acromyrmex echinatior (Panamanian leafcutter ant)
Pathway
aec04013  MAPK signaling pathway - fly
aec04214  Apoptosis - fly
aec04215  Apoptosis - multiple species
aec04391  Hippo signaling pathway - fly
Brite
KEGG Orthology (KO) [BR:aec00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04013 MAPK signaling pathway - fly
    105150106
   04391 Hippo signaling pathway - fly
    105150106
 09140 Cellular Processes
  09143 Cell growth and death
   04214 Apoptosis - fly
    105150106
   04215 Apoptosis - multiple species
    105150106
SSDB
Motif
Pfam: TNFR_c6 Trp_oprn_chp CD225
Other DBs
NCBI-GeneID: 105150106
NCBI-ProteinID: XP_011061270
UniProt: F4W6A6
LinkDB
Position
Unknown
AA seq 342 aa
MPRESCPLLLTLVSIFVGLCESSAAPGAATSGTQQPQPQPQQQPPPQSQQQHPICRPGLE
FWSTERASCWPCTRCAPEFTLSPCVIHKDAICGPLSALELDWSFLSSTARKRPSRAGDDD
GTVTSNTFLRFSEEKTKERPFVEADNLINPGREGDKEPVSASQESKAAYDPRERRKSAIE
DNLPWDWQTGALVLAVCACIVFFLVAGCSAIVYARQWRRMKRNFEPAGLEEISARLNLMV
KAELAELVAGAPMNPGDPETRCQYLEKLLDRKRETPVVATAATATAAATAAAAAAAGWPE
AATGNLYIEEGGTTTPRSKRSQIARIQRNIETILSHKTNQGD
NT seq 1029 nt   +upstreamnt  +downstreamnt
atgccgagggaatcctgccccttgctgttgaccctggtgtcgatattcgtcggcctgtgc
gagtcctccgccgcccctggagccgcaacatccggcactcagcaaccacagccgcagcca
cagcagcagccgccgccgcagtcgcagcagcagcatccaatttgtaggcccggtttggag
ttttggtccaccgaacgcgcctcgtgctggccgtgtactcgatgtgcccccgagttcacc
ttaagtccgtgtgtgattcacaaggacgcgatatgcggcccactgtcagcgctcgagctc
gactggtccttcctgtcgtcgacggccaggaagagaccctcgcgagccggcgatgacgat
gggaccgtcacctcgaacacgtttctgcggttctctgaagagaagacgaaagaacggccc
ttcgtggaagccgataatctcatcaaccccggtcgtgaaggcgacaaggagccggtctcc
gcctcgcaggaatcgaaagcggcgtatgatcctcgggagaggagaaaatcggccatcgaa
gacaatctaccgtgggactggcaaaccggtgctctggtccttgcggtatgcgcttgcata
gtattcttcctggtagcaggatgctcggctattgtctatgcgaggcaatggcggcggatg
aagaggaactttgagccggcgggtctcgaggaaatctcagctagattgaacctgatggtg
aaggcggagctggccgaattggtcgcaggagcaccgatgaatccaggtgatcccgaaaca
agatgtcagtatctcgagaagcttttagaccggaaacgggagactccggtggtggcgacg
gcggcgacggcgacggcggctgcaacggcggcggcggcggcggcggctggctggccggag
gcagcaaccggcaacttgtacatcgaagaggggggcacaacgacaccgaggagtaaacga
tcgcaaatcgcacggattcaacgtaacatcgagaccattctcagtcacaagacgaatcag
ggcgattga

DBGET integrated database retrieval system