KEGG   Acromyrmex echinatior (Panamanian leafcutter ant): 105151236Help
Entry
105151236         CDS       T03917                                 

Definition
(RefSeq) succinate dehydrogenase [ubiquinone] flavoprotein subunit, mitochondrial-like
  KO
K00234  succinate dehydrogenase (ubiquinone) flavoprotein subunit [EC:1.3.5.1]
Organism
aec  Acromyrmex echinatior (Panamanian leafcutter ant)
Pathway
aec00020  Citrate cycle (TCA cycle)
aec00190  Oxidative phosphorylation
aec01100  Metabolic pathways
aec01200  Carbon metabolism
Module
aec_M00009  Citrate cycle (TCA cycle, Krebs cycle)
aec_M00011  Citrate cycle, second carbon oxidation, 2-oxoglutarate => oxaloacetate
aec_M00148  Succinate dehydrogenase (ubiquinone)
Brite
KEGG Orthology (KO) [BR:aec00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    105151236
  09102 Energy metabolism
   00190 Oxidative phosphorylation
    105151236
Enzymes [BR:aec01000]
 1. Oxidoreductases
  1.3  Acting on the CH-CH group of donors
   1.3.5  With a quinone or related compound as acceptor
    1.3.5.1  succinate dehydrogenase
     105151236
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: FAD_binding_2 Succ_DH_flav_C Pyr_redox_2 DAO Thi4 FAD_binding_3 HI0933_like GIDA Lycopene_cycl NAD_binding_7 NAD_binding_8 FAD_oxidored
Motif
Other DBs
NCBI-GeneID: 105151236
NCBI-ProteinID: XP_011063126
LinkDB All DBs
Position
Unknown
AA seq 615 aa AA seqDB search
MCTNNYPLIDHCYDVVIVGAGGAGLRAAFGLGKKGYRVAVVSKLFPTRSHTVAAQGGINA
AISNQQNDNWLYHMYDTVKGSDWLGDQDAIHLLTREAPRAVYELENYGCPFSRTDEGTIY
QRAFGGQSLKFGKGGQAKRTCAVADRTGHSVLHTLYGQSLRYDVHYFIEYYALDLLMYGR
CCKGVLAWELETGLLHRFRGHHTVIATGGAGRCYFSCTAAHACTGDGMAIACRAGLPLQD
MEFIQFHPTGIYGTGILITEGSRGEGGKLVNSKGEFFMEKYAPVAKDLASRDVVSRAMTM
EILEGSGVGEKKDHIYLQLTHLPPDLIRKRLPGISHLARIFAGVDVKKQPIPVIPTVHYN
MGGIPTNWRAQVLTRENEEDKPVEGLWAAGETACASVHGANRLGANSLLEIVVFGRAIAD
QIDCIARPGERHGDLPPDIGEQSICRFDATRYAKGCVPVAELRGEMQRTMQRYCGVFRTC
DILQRGCREMSRLYTCELPDLCVQDQSLIWNSELVEALELQNMMLVCMHTVYAAENRKES
RGSHAREDFKDRIDEYDYSKPLEGQKKRPYTEHWRKHSLTWAQEDGTIYISYRPVIDTTL
DETEAQHVPPAIRVY
NT seq 1848 nt NT seq  +upstreamnt  +downstreamnt
atgtgtacaaataattatcctctgatagaccactgctatgatgtagtaatagtaggagca
ggtggtgctggattgagggcggcttttggacttggtaaaaaaggatatcgtgtagcagta
gtatcaaaactctttccgactaggtcacataccgtagctgcccagggtggcataaacgct
gctatctccaatcagcaaaatgataattggctgtatcatatgtatgatactgtgaaggga
tccgattggctaggggatcaggatgctatacatttactcacgagggaagcgcctcgagcg
gtctatgaactcgaaaattacggctgcccctttagtcgtacagatgagggtacaatatat
cagcgtgcttttggtggccagtcgttaaaatttggcaaaggcggacaagctaaacgaacc
tgtgctgtcgctgatcgaaccggtcattcggtacttcataccctttacggccagagtctt
cgctacgatgtgcattatttcatcgagtattacgccctcgatttacttatgtacggtcga
tgttgcaaaggggttctggcttgggaattggagaccggactcctacaccgattcagaggt
catcatacagtgattgcaacaggtggtgccggaagatgttacttctcctgcaccgctgcg
cacgcctgcactggtgacggcatggcaatcgcatgtcgagcaggattgccgttgcaagac
atggaattcattcagtttcacccgaccggtatttatggaactggcatacttataaccgaa
ggtagccgtggagaaggcggcaaactcgtcaactctaagggagagtttttcatggagaaa
tacgcgccagtggctaaggatttagcttctcgtgacgtcgtgtcgagagctatgactatg
gaaatactggaaggaagtggcgtcggggagaagaaggatcacatttatttgcagttaact
catttgccgcctgacttgatacgcaagagactgcccggaatttcgcacctcgcccggata
tttgccggagtagacgtgaagaagcaaccgatccccgtgattcccacggtacattataac
atgggcggtatacccacaaattggcgtgcgcaagtattaacacgagaaaatgaagaggac
aaaccagtcgaaggtctctgggcagctggcgagaccgcgtgtgcgtccgttcacggtgct
aatcgcttgggcgctaatagtctcttagaaattgtggtctttggcagagccatcgccgat
caaatcgattgcattgccagacctggcgaacgtcacggagatctgccgccagatattggt
gaacagtcgatttgtcgctttgacgcaacccgttatgcgaaaggctgcgttcccgtggcc
gagctgcgtggagagatgcaacgtacgatgcagagatattgcggagtattcagaacttgc
gacattttgcagcgcggatgcagggagatgtcccgtctctatacctgtgaactgccggat
ttatgcgtgcaagatcagtctcttatttggaacagtgaactcgtcgaagccttggagttg
caaaacatgatgctagtctgtatgcacactgtatacgcagccgaaaatcgaaaggaatcg
agaggatcgcacgctagggaagacttcaaggacagaattgacgagtatgattattcgaaa
ccgctcgagggacaaaagaaacgaccttacacggaacactggcgtaaacattcgcttacg
tgggctcaggaggatggaacgatctatatctcttatcggcccgttatcgatacgacttta
gacgaaaccgaggctcagcatgtacctcctgcaattcgcgtatactga

DBGET integrated database retrieval system