KEGG   Acromyrmex echinatior (Panamanian leafcutter ant): 105151265Help
Entry
105151265         CDS       T03917                                 

Definition
(RefSeq) alpha-amylase
  KO
K01176  alpha-amylase [EC:3.2.1.1]
Organism
aec  Acromyrmex echinatior (Panamanian leafcutter ant)
Pathway
aec00500  Starch and sucrose metabolism
aec01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:aec00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00500 Starch and sucrose metabolism
    105151265
Enzymes [BR:aec01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.1  alpha-amylase
     105151265
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Alpha-amylase Alpha-amylase_C
Motif
Other DBs
NCBI-GeneID: 105151265
NCBI-ProteinID: XP_011063178
LinkDB All DBs
Position
Unknown
AA seq 496 aa AA seqDB search
MNMMRILLCALAILSAVLAQKDLHYVPGHDGMVHLFEWKWGKIAEECENFLGPIGFGGIQ
VSPVQENVIVKNRPWWERYQPISYKWNTRSGTAKEFKDMVRRCNNAGVRIYVDVVFNHMT
GNHANAKGTGDSTADTNNFNYPGVPYSESDFHVSCPINNYQDAGNVRNCELSGLHDLDQS
KEYVRDKIVNFLNEIIDVGVAGYRVDAAKHMWPEDLKVIYSRVKNLNPKYNFPSDARPYV
FQEVIDYGGEAISKYEYNSFGAVTEFRYGMELSNALNGKNNLKWFSNWGEAWGLLPSQDA
LVFIDNHDTQRSHSEILTYKSSKKYKMAVAFMLAHPYGTARIMSSFGFESFDANPPQDSK
GNLISPTINSDNTCGNGWICEHRWRQIYNMVRFRNAANNTDVNNWWDNGQNQIAFSRGNA
GFIAINGDGHDFKQHLFTSLQPGTYCDVISGNLEDNKCTGKIVRVDQNGKAYIEILANEE
DGVLAIHRQAKVGCSC
NT seq 1491 nt NT seq  +upstreamnt  +downstreamnt
atgaacatgatgcgaatactattgtgtgcattagcgatactgtcagcagtactcgctcag
aaagatctgcattatgtgcccggccacgatgggatggtgcatctttttgaatggaaatgg
ggaaagattgcagaagaatgtgaaaatttcctcggtcccataggattcggtggcatacaa
gtttctccggtccaagagaatgtgatcgtaaagaatagaccatggtgggaacgttatcaa
cctatatcttataaatggaatacgagatcgggcacggcgaaggaattcaaggacatggtt
cgcagatgtaacaatgccggcgtaaggatttacgtcgatgtggtcttcaaccacatgacc
ggaaatcacgctaacgcaaagggtactggcgattcaacagcggatactaataacttcaat
tatccgggcgtaccgtattctgaatccgattttcacgtctcttgccccatcaacaattac
caagatgcgggaaatgtgcggaattgcgagctatccggcctgcatgatctcgatcagtca
aaagaatatgtcagagacaagatagtcaacttcttgaacgaaataatcgatgttggagtc
gctggctatcgagtagacgcagctaaacacatgtggccggaggatctaaaagtaatctac
tctcgagtgaaaaatctcaatcccaagtataatttcccttcagatgcgcgaccttatgta
ttccaagaggtgattgattatggcggcgaagcaatcagtaaatatgaatacaactctttc
ggcgcggttacggaattccgatacggtatggagctcagcaacgccttgaacggaaagaat
aatttgaaatggttttccaattggggagaagcttggggtttgttaccatctcaggatgct
ctagtatttattgacaatcatgatactcaacgtagccactccgaaatacttacctacaag
tcatcgaagaaatacaagatggctgttgctttcatgctggcacatccttatggaactgcg
cgtatcatgagttccttcggttttgagagttttgacgccaacccaccgcaagattctaaa
ggaaatcttatatctccaaccatcaactctgacaatacctgcggtaacggttggatctgc
gagcatcgatggcgtcagatttacaacatggtgcgcttccgaaacgctgcgaataatacc
gacgtgaacaactggtgggacaatggccagaatcaaatcgctttcagtcgcgggaacgcg
ggtttcattgcgatcaatggtgacggacatgacttcaagcagcatctctttacttctctg
cagcctggtacttactgcgacgttatctctggaaatttggaggataacaagtgtaccggt
aagatcgtaagagtagatcaaaatggaaaggcgtatatagaaatcttggcgaatgaggaa
gatggtgtgctcgccattcatcgacaggcaaaggtgggatgtagttgttga

DBGET integrated database retrieval system