KEGG   Acromyrmex echinatior (Panamanian leafcutter ant): 105152578Help
Entry
105152578         CDS       T03917                                 

Definition
(RefSeq) alpha-glucosidase-like
  KO
K01187  alpha-glucosidase [EC:3.2.1.20]
Organism
aec  Acromyrmex echinatior (Panamanian leafcutter ant)
Pathway
aec00052  Galactose metabolism
aec00500  Starch and sucrose metabolism
aec01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:aec00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00052 Galactose metabolism
    105152578
   00500 Starch and sucrose metabolism
    105152578
Enzymes [BR:aec01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.20  alpha-glucosidase
     105152578
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Alpha-amylase Malt_amylase_C Alpha-amylase_C Cyc-maltodext_C
Motif
Other DBs
NCBI-GeneID: 105152578
NCBI-ProteinID: XP_011065250
UniProt: F4X452
LinkDB All DBs
Position
Unknown
AA seq 567 aa AA seqDB search
MKSIITLYAILLLSNLGYSASTPKWWQSMSLYQIYPRSFKDSDGNGVGDLKGIISKLEHL
SESNVDAFWLSPIYPSPMIDFGYDISDFVSIDKMFGTMKDFEVLVQATHAASMKIIMDFV
PNHSSDQHEWFQKSLQNIKPYTNYYIWHKGKVLPNGTVTVPNNWVSVFGGPAWTWREERQ
AYYFHQFAPQQPDLNYENENVVNAMKDVMRFWLDKGVDGFRMDAVPHLCEDVRFLDEPLT
GNSNPNDYGYTYKIYTKDLPYTYEIVKGWREVLNEYSDEKVMMIEAYANMTMTIKYYVYG
AHFPFNFGFITDTNQNSKAIDFKRLIDRWMVNMPVLRATANWVAGNHDKPRLVTRYGRYR
AEVITMITLLLPGVAVTYNGDEIGMEDTWISWEDTKDPQGCNAGKDVYEKASRDPARTPF
QWDNTTSAGFSTNQKTWLPVNKNYLTLNLAAQKEQNNSYNALYKAVSALRKLPVIKHGAL
TTTLLNNDVFAFIRKINGEVVYVIANFANEEETVDLSTLVYALSQLNVYYATTNAHHLIG
NIIKDVYAVKIPALGAVIYTSTIYKAK
NT seq 1704 nt NT seq  +upstreamnt  +downstreamnt
atgaagagcataataacactttatgcgatattactattgtctaatctcggatatagtgca
tctactccaaaatggtggcagtcaatgtccctttatcaaatttatcctagaagtttcaag
gatagtgatggtaacggtgtcggagatcttaaaggtatcataagcaaactggaacatctc
agtgagtcgaatgttgatgctttctggttatctccgatttatcctagcccgatgattgat
tttggttacgatatttccgatttcgtcagtatcgacaaaatgtttggcactatgaaggat
tttgaggtactcgtacaagccacgcatgctgcatcaatgaagatcattatggattttgtt
cctaatcattcgtcggatcagcacgaatggttccaaaaaagtttacaaaacataaaacct
tatactaactattacatatggcataaaggcaaggtgctaccaaacggaacagttacagtg
ccgaataattgggtgagcgtgttcggtggaccagcatggacctggcgtgaagaacgacaa
gcgtattattttcatcaattcgcaccacaacaacccgatctcaactatgagaatgagaat
gtagtgaatgcaatgaaggatgtcatgagattttggctcgacaagggggtggatggcttc
cggatggacgcggtgccacatttgtgtgaggacgtcagattcttggacgaaccactcacg
ggtaattcaaatcctaatgattacggctacacatacaagatatacacgaaggatcttccg
tatacctacgaaatagtcaaaggatggagagaagtgttgaacgaatattcagatgaaaaa
gttatgatgatcgaggcttacgcgaacatgacgatgacgataaagtattatgtatacggc
gcacactttcccttcaattttggttttattaccgatacgaatcagaattctaaagcaatt
gatttcaagagattgattgatagatggatggtaaacatgcctgttttgagagcaactgct
aactgggtggcaggaaatcatgacaaaccacgattggtcactcgttacggacgatatcga
gcggaagttataaccatgataactttactgcttcctggagtagctgtaacttataacggg
gatgaaatcggtatggaggacacgtggatctcatgggaagacaccaaagatccgcaaggt
tgcaatgccggcaaagatgtttacgagaaagcatctcgagatcccgcaagaacgccgttc
caatgggacaacaccacttcggctggattttccacgaatcagaaaacgtggctgccggtg
aacaaaaattacttgacacttaatttagccgcgcaaaaagaacaaaacaactcttacaat
gctttgtataaagcagtttctgctctgagaaaattgcctgttattaaacatggagcctta
accacgacattattgaataatgatgttttcgcttttattagaaaaattaatggagaggta
gtttacgtaatagcaaactttgcaaatgaagaagaaaccgttgatttatcaacgcttgtt
tatgcattaagtcaattaaacgtttattatgccactactaatgctcatcatctcattgga
aacattatcaaagatgtttatgccgtaaaaattcctgcattaggagctgtgatatatact
agcaccatatataaagctaagtaa

DBGET integrated database retrieval system