KEGG   Acromyrmex echinatior (Panamanian leafcutter ant): 105154840Help
Entry
105154840         CDS       T03917                                 

Definition
(RefSeq) carbonic anhydrase 2-like isoform X1
  KO
K01672  carbonic anhydrase [EC:4.2.1.1]
Organism
aec  Acromyrmex echinatior (Panamanian leafcutter ant)
Pathway
aec00910  Nitrogen metabolism
aec01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:aec00001]
 09100 Metabolism
  09102 Energy metabolism
   00910 Nitrogen metabolism
    105154840
Enzymes [BR:aec01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.1  carbonic anhydrase
     105154840
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Carb_anhydrase
Motif
Other DBs
NCBI-GeneID: 105154840
NCBI-ProteinID: XP_011068904
LinkDB All DBs
Position
Unknown
AA seq 299 aa AA seqDB search
MRILQIVTAWLILIVIPHCGIHGFGYSKREQHLWPKKYKLCAGKRQSPVAICTSKAIVKP
FPALELIGYHDFFPMPQLLKNNGNTVILRVDKNETQVHRTLPYIFGGMLRNQTFEMEEVH
FHWGLKNNRGAEHVLNGLRYSMETHIIHYNMAYGNYVNAAQHDDGIAVVASFFQLQDEDN
ERLQPFISKLSDVQWAHTELSVNIYLTLASLIPSNTDVFYAYKGSLTTPPCNEVVTWHIF
ANPIPISFHQMNMFRKLLNGEGILGDNFRLLQDIGQRKIYIRRLDPTISMKDIKHDLKC
NT seq 900 nt NT seq  +upstreamnt  +downstreamnt
atgcgtatcttacaaattgtaacggcgtggctgattctcatcgttataccgcactgtggc
atccatggttttggatacagtaagagagagcaacacttgtggccgaagaagtacaaatta
tgcgcaggaaaacgacaatcaccagtggctatatgcacatcaaaagcgatcgttaaacca
tttccggctcttgaattgattggttatcacgatttttttccaatgccgcaattattaaaa
aataatggaaacactgttatacttagagtagacaaaaatgagacacaagtacatagaaca
ttgccttatatatttggaggcatgctgcgaaatcaaacatttgaaatggaagaagtgcac
tttcattggggtttaaaaaataatagaggtgccgaacatgtactaaacggtttaagatat
tcaatggaaacgcatattatacattacaacatggcatatggcaattatgtaaatgcggca
caacacgacgatggtatagccgtagtagcttctttcttccagttgcaagatgaagacaac
gagcgtcttcaaccttttataagtaagttatctgatgtgcaatgggcacatacagagtta
tcggtcaatatatatctcactctagcatccctaataccgtcaaacacagatgtcttttac
gcatacaaaggatctctcacaactccgccttgtaacgaagtagtcacctggcacattttc
gccaatccaattccaatatccttccatcagatgaacatgttccggaaactcttaaacggc
gaaggaattttgggcgataattttagattattacaagatatcggtcaacgtaaaatatat
attagaagattagatccaacaatctcgatgaaagatatcaaacacgatttaaaatgctga

DBGET integrated database retrieval system