KEGG   Acromyrmex echinatior (Panamanian leafcutter ant): 105154970
Entry
105154970         CDS       T03917                                 

Definition
(RefSeq) fibroblast growth factor 2-like isoform X1
  KO
K18496  fibroblast growth factor 1
Organism
aec  Acromyrmex echinatior (Panamanian leafcutter ant)
Brite
KEGG Orthology (KO) [BR:aec00001]
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04052 Cytokines and growth factors [BR:aec04052]
    105154970
   00536 Glycosaminoglycan binding proteins [BR:aec00536]
    105154970
Cytokines and growth factors [BR:aec04052]
 Growth factors
  Growth factors (RTK binding)
   105154970
Glycosaminoglycan binding proteins [BR:aec00536]
 Heparan sulfate / Heparin
  Growth factors/receptors
   105154970
SSDB
Motif
Pfam: FGF
Other DBs
NCBI-GeneID: 105154970
NCBI-ProteinID: XP_011069091
LinkDB
Position
Unknown
AA seq 299 aa
MHVKKLEGACSVFNSLHQESMHRSLTPVTDVSRSASCLLLFDEPRKNRAQLRDKRRAPSR
REIAKMSLRWIHENLKAPTCDEECSDIDDSCSDDSCDTELFLQEADVVKNEKDIARDSRK
KRETRRAPTSTVTFDGNGTPRNIERNCKSRKYPPYVIWDPRQPAKNPIYNCRIIKLYCRT
GYHLAITSSGRVEGLSGNKEPYDLLYASPVSFGVIRIQSIETRLYLAFNKKGRLYGEINM
TNENTEWEQWSIGSHDAFRSRKYVQYGWWIGIKKNGRVKLGSKTFWGQKAIQFSAIQED
NT seq 900 nt   +upstreamnt  +downstreamnt
atgcatgtgaaaaaactcgaaggcgcgtgttctgtttttaattcgcttcaccaggaatcc
atgcatagatcgctgacgccagtgactgatgttagtaggtcggcgtcatgtctgctatta
ttcgacgagccgcggaagaaccgagctcagttgcgtgataaacgtagagcacccagcaga
agggaaattgcaaaaatgagtttgcgctggattcatgagaatctaaaagcgcctacgtgt
gacgaggagtgcagcgatatcgacgacagttgcagcgacgatagctgcgacacggaattg
ttcctccaggaggcggatgtggtgaagaatgaaaaagatatcgctcgcgatagccgaaag
aagagggaaaccagaagagccccgacttcgaccgttacgttcgacgggaatggaacgcca
cgcaacattgaacgtaactgcaaatcacgcaagtacccaccttacgtaatatgggatcca
cgacaaccagcaaaaaatcctatctataattgccggataattaagttgtactgtcgcacc
ggatatcatctagcaattacatcatcgggacgagtggaaggattatccggaaacaaggag
ccatatgatctgctttacgcatcaccggtatcttttggcgttatcagaatacaaagcatc
gaaacaaggctatatttggcattcaacaagaaagggcgattgtacggagagataaatatg
actaatgaaaacaccgaatgggaacaatggagcattggttcccatgacgcgttcagatca
cgtaaatacgtgcaatatggatggtggataggaataaagaaaaatggacgagtaaagctt
gggtcgaaaacattttggggacaaaaggctatacaattttcggctatccaagaggattaa

DBGET integrated database retrieval system