KEGG   Acromyrmex echinatior (Panamanian leafcutter ant): 105155041Help
Entry
105155041         CDS       T03917                                 

Definition
(RefSeq) glycogen [starch] synthase isoform X1
  KO
K00693  glycogen synthase [EC:2.4.1.11]
Organism
aec  Acromyrmex echinatior (Panamanian leafcutter ant)
Pathway
aec00500  Starch and sucrose metabolism
aec01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:aec00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00500 Starch and sucrose metabolism
    105155041
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01003 Glycosyltransferases [BR:aec01003]
    105155041
Enzymes [BR:aec01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.1  Hexosyltransferases
    2.4.1.11  glycogen(starch) synthase
     105155041
Glycosyltransferases [BR:aec01003]
 Polysaccharide
  Storage polysaccharide
   105155041
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Glycogen_syn Glyco_transf_5 Glycos_transf_1 Glyco_transf_4 Glyco_trans_1_4 Glyco_trans_4_4
Motif
Other DBs
NCBI-GeneID: 105155041
NCBI-ProteinID: XP_011069220
LinkDB All DBs
Position
Unknown
AA seq 692 aa AA seqDB search
MSRERASRRFYRIDSTNDLFGFMDRGYSAQHENRWNFEVAWEAANKVGGIYTVIRSKAYV
STEEMGDQYCLIGPYKEHSARTEVEEADFPPHNPLHQAVQVLRDQGYKVITGTWLVDGNP
QIILFDIGSAAWKLDEYKQELWSTCNLGIPHLDIEANDAVILGYLVCQFIAEFRKAAEGY
SSIPPRVVVHCHEWQAGVGLIALRTRHVDVATVFTTHATLLGRYLCAGKTDFYNNLDKFS
VDEEAGKRQIYHRYCMERAATHLAHVFTTVSDITGFEAEHLLKRKADIITPNGLNVKKFA
ALHEFQNLHAISKEKIHEFVRGHFYGHYDFDLDKTLYFFTAGRYEFGNKGADIFIEALAR
LNHYLKTSRPDLTVVAFLIFPARTNNFNVESLRGHAVTKSLRDTINDIQQKIGKRMYELC
LSGRMPEAQDLLEKEDTIKIKRCLYALQRNGLPPITTHNVVDDWNDPVLNAIRRCNLFNT
VHDRVKMVFHPEFLSSTNPLFGLDYEEFVRGCHLGVFPSYYEPWGYTPAECTVMGIPSIT
TNLSGFGCFMQEHIADPMSYGIYIVDRRFIGLEASVQQLAQYMFDFARLSRRQRIIQRNR
TERLSDLLDWRNLGIYYRQARIKALTTVYSELASEYAEGGIGRFNYPRPISEPPSPSSSR
HTTPAASVHGSDDEDEVDDEKELEELRQSNGR
NT seq 2079 nt NT seq  +upstreamnt  +downstreamnt
atgtcgagagagcgtgcttctagaagattttatcgcatagacagcactaatgatttgttt
gggtttatggaccgtggctactcagcccaacatgaaaatcgatggaactttgaagttgct
tgggaagctgccaataaagttggcggcatttatactgtaataagatctaaagcttatgtc
tcaactgaagaaatgggtgatcaatattgtcttattggtccatataaagaacattcagca
cgtactgaagttgaggaggcagactttcctcctcataatccattgcatcaagcagtacaa
gttttacgtgatcaaggatataaagtaataacaggaacatggttggtggatggaaatcct
caaataattctattcgatatcggaagtgctgcttggaagctggacgagtataaacaggaa
ttatggagtacttgcaatcttggaatacctcatctcgatattgaagctaatgatgctgta
atacttggatatttagtctgtcaatttattgcagaatttagaaaagcagccgaaggttac
tcaagcattccgccgagagttgtcgtacattgtcatgaatggcaagcaggtgttggttta
atcgctttgagaacaagacacgtggatgtggccacagtatttactactcatgctacactt
ctgggtagatatctttgtgcagggaagacagatttttacaacaatttagataagtttagt
gttgatgaagaagcaggaaagcgtcagatatatcacagatattgtatggaacgtgcagct
acacatttagcacacgtatttacaacagtttcggatatcactggttttgaagctgaacat
ttgctcaaacggaaagctgatattatcacgccaaatggattaaatgtaaaaaagtttgcg
gcattgcatgaatttcagaatttacatgctattagtaaagaaaaaatacatgagtttgtg
cgaggccacttttatggacattatgattttgatttagacaaaacattatatttctttacc
gctggtcgatatgaatttggaaataaaggagctgatatattcatagaagctctagccaga
ttaaatcattatttaaaaacgtccagacctgacttaacagtagttgccttccttattttt
cctgcaagaactaataattttaatgtcgagtctctccgcggtcatgctgtaacaaaatct
ctacgagatactatcaatgatatacagcaaaaaatagggaaacggatgtatgaattatgt
ctctctggtcgcatgcctgaagctcaggacttattggagaaagaggatactattaaaata
aaacgatgtttatatgctctgcaaagaaacggattaccacctattacgacacataatgtt
gttgatgattggaatgatccggtgttaaatgccattagaagatgtaatcttttcaacact
gtccatgatcgtgttaagatggtatttcatccagaatttttatcttcgacaaatccacta
tttggtcttgattatgaggaatttgttagaggatgtcatttaggtgtttttccttcatat
tatgaaccgtggggttatacaccagctgagtgcacagttatgggaatacccagcattacc
acaaacttatcaggatttggatgttttatgcaggagcatatagcagatccgatgagctat
ggtatttacattgttgataggcgttttattggtttagaagcaagtgttcaacagcttgct
cagtatatgtttgatttcgcacgacttagccgtcgtcaacgtatcattcaaagaaatcgt
acagaacgtcttagtgatctcctcgattggcgaaatcttggcatttattatcgtcaagca
agaataaaggcgttgaccacagtgtattcagaactggcatcagaatatgcagagggtggg
attggtcgattcaattatcccagaccaatcagtgaaccaccatctccatcatcttcacga
catacgacaccggccgcttctgtacatggttcagatgacgaggatgaagttgatgatgaa
aaagagctagaagaattacgacaatcaaatggaagataa

DBGET integrated database retrieval system