KEGG   Aeromicrobium sp. MF47: GEV26_12150
Entry
GEV26_12150       CDS       T06272                                 

Definition
(GenBank) aminotransferase class V-fold PLP-dependent enzyme
  KO
K04487  cysteine desulfurase [EC:2.8.1.7]
Organism
aef  Aeromicrobium sp. MF47
Pathway
aef00730  Thiamine metabolism
aef01100  Metabolic pathways
aef04122  Sulfur relay system
Brite
KEGG Orthology (KO) [BR:aef00001]
 09100 Metabolism
  09108 Metabolism of cofactors and vitamins
   00730 Thiamine metabolism
    GEV26_12150
 09120 Genetic Information Processing
  09123 Folding, sorting and degradation
   04122 Sulfur relay system
    GEV26_12150
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03016 Transfer RNA biogenesis [BR:aef03016]
    GEV26_12150
   03029 Mitochondrial biogenesis [BR:aef03029]
    GEV26_12150
  09183 Protein families: signaling and cellular processes
   02048 Prokaryotic defense system [BR:aef02048]
    GEV26_12150
Enzymes [BR:aef01000]
 2. Transferases
  2.8  Transferring sulfur-containing groups
   2.8.1  Sulfurtransferases
    2.8.1.7  cysteine desulfurase
     GEV26_12150
Transfer RNA biogenesis [BR:aef03016]
 Eukaryotic type
  tRNA modification factors
   Thiolation factors
    GEV26_12150
 Prokaryotic type
    GEV26_12150
Mitochondrial biogenesis [BR:aef03029]
 Mitochondrial quality control factors
  Regulator of mitochondrial biogenesis
   Proteins involved in Fe-S cluster biogenesis
    GEV26_12150
Prokaryotic defense system [BR:aef02048]
 DNA phosphothiolation system
  Sulfur modification proteins
   GEV26_12150
SSDB
Motif
Pfam: Aminotran_5 Beta_elim_lyase DegT_DnrJ_EryC1 Aminotran_3 Pyridoxal_deC
Other DBs
NCBI-ProteinID: QGG42061
UniProt: A0A5Q2MJY0
LinkDB
Position
complement(2469550..2470755)
AA seq 401 aa
MNDSDGTVYLDHAATTPMVPEAIAAMTEQMARTGNASSLHAAGRAARRTVEEARELIAER
FGARPSEIVFTSGGTEANNLAIKGLYWSRRSQHPDRRRIVFSSIEHHALLDPVTWLAMHE
GADVDMTPVDKQGRIVVDDLRAAVERDPASVAAVTTMWANNEMGTIQPIPEVVEIARAYD
IPVHSDAVQAAGYLPLDFAGSGLDAMTITAHKLGGPVGVGALMIGREIDATPLLHGGGQE
RDLRSGTLSVPLIAAFAAAVEVTVSQQAETFARIEALRQRLVEGVVRVVPDAIVNGDPLP
GPDHRLPNIAHVTFPGCEGDAMLMLLDAQGIECSTGSACAAGVPQPSHVLLAMGYDDVAA
RGSLRFSLGHTSTEADVDRLLAALPAVHQRAMRASLVRSGS
NT seq 1206 nt   +upstreamnt  +downstreamnt
atgaacgactcggacggcaccgtctatctcgaccatgcggcgaccacgccgatggtcccc
gaggcgatcgccgcgatgaccgagcagatggcccgcacgggcaacgcctcctccctccac
gccgccggccgcgccgcccgccgtaccgtcgaggaggcccgtgagctgatcgccgaacgc
ttcggcgcccggcccagcgagatcgtcttcacctcgggcggcaccgaggccaacaacctc
gcgatcaagggcctctactggtcacgccgcagccagcaccccgaccgcaggcgcatcgtc
ttcagctcgatcgagcaccacgcactcctcgaccccgtcacgtggctcgcgatgcacgag
ggcgcggacgtcgacatgaccccggtcgacaagcagggccgcatcgtggtcgacgacctg
cgggcagcggtcgagcgcgatcccgcgagcgtcgcggcggtcaccacgatgtgggccaac
aacgagatgggcacgatccagccgatccccgaggtcgtcgagatcgccagggcgtacgac
atcccggtgcacagcgatgcggtgcaggctgcgggctatctcccgctcgacttcgccggg
agcggtctcgacgcgatgacgatcacggcccacaagctgggcggaccggtcggcgtcggc
gccctgatgatcggccgtgagatcgacgcgacaccgctgctgcacggcgggggacaggag
cgcgacctgcgctcgggcacgctcagcgtgccgctcatcgccgccttcgccgccgcggtc
gaggtgacggtgagtcagcaggccgagaccttcgcccgcatcgaggcactgcgccagcgt
ctcgtcgagggggtcgtgcgcgtcgtccccgacgcgatcgtcaacggcgacccgctgccg
ggtccggatcatcgcctgcccaacatcgcccacgtgacgttcccggggtgcgagggcgac
gcgatgctgatgctgctggacgcccaaggcatcgagtgctcgaccggctcggcgtgcgcc
gccggcgtgccccagcccagtcacgtcctgctggcgatgggctacgacgacgtcgccgcc
cgcgggtcgctgcgcttcagcctcggccacacctcgaccgaggcggacgtcgaccgcctg
ctcgcggcgctgccggccgttcaccagcgggccatgcgggcctcgctcgtgcggagcggg
tcatga

DBGET integrated database retrieval system