KEGG   Alkalilimnicola ehrlichii: Mlg_0340Help
Entry
Mlg_0340          CDS       T00391                                 

Definition
(GenBank) pyrroline-5-carboxylate reductase
  KO
K00286  pyrroline-5-carboxylate reductase [EC:1.5.1.2]
Organism
aeh  Alkalilimnicola ehrlichii
Pathway
aeh00330  Arginine and proline metabolism
aeh01100  Metabolic pathways
aeh01110  Biosynthesis of secondary metabolites
aeh01130  Biosynthesis of antibiotics
aeh01230  Biosynthesis of amino acids
Module
aeh_M00015  Proline biosynthesis, glutamate => proline
Brite
KEGG Orthology (KO) [BR:aeh00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00330 Arginine and proline metabolism
    Mlg_0340
Enzymes [BR:aeh01000]
 1. Oxidoreductases
  1.5  Acting on the CH-NH group of donors
   1.5.1  With NAD+ or NADP+ as acceptor
    1.5.1.2  pyrroline-5-carboxylate reductase
     Mlg_0340
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: P5CR_dimer F420_oxidored NAD_binding_2 GFO_IDH_MocA Shikimate_DH NAD_Gly3P_dh_N CoA_binding PDH UDPG_MGDP_dh_C
Motif
Other DBs
NCBI-ProteinID: ABI55695
UniProt: Q0ABU2
LinkDB All DBs
Position
complement(383708..384535)
Genome map
AA seq 275 aa AA seqDB search
MSNNTLCFIGGGNMARSLIGGLLADGFDPQAVRVADPDAGKRDDLANRFGVRVYADNLEA
AADADTVILAVKPQVVRTACEQLVAGSGDAGRLFISIAAGVREPDLTRWLGGQAAVVRTM
PNTPSLVGTGATALYANDRVKERQRELAESLMRAVGLVVWLDDEAQMDTVTAVSGSGPAY
FFLLMEAIEDAARDLGLPGETARLLTIETALGAAKMALESDESPAQLRQRVTSPGGTTEH
ALHVLEDGEYRALMTRAVQAAAKRAQELGQMLGEQ
NT seq 828 nt NT seq  +upstreamnt  +downstreamnt
atgagcaacaacaccctgtgctttatcggcggcggcaacatggcccgctcgctgatcggc
ggcctgctggccgacggtttcgacccgcaggcggtacgggtggccgacccggacgccggc
aagcgcgatgacctggccaaccgtttcggcgttcgggtctacgccgacaacctggaggcg
gccgccgacgccgacaccgtgatcctggcggtcaagccccaggtggtgcgtaccgcctgc
gagcagttggtggccggcagcggcgacgccgggcggctgtttatctccatcgcggcgggc
gtgcgcgagccggacctgacccgctggctcgggggccaggccgcagtggtgcggaccatg
cccaacaccccctcgctggtgggcaccggcgccacggcgctgtacgccaacgaccgggtc
aaggagcggcagcgggagctggcggaatcattgatgcgcgccgtggggctggtggtctgg
ctcgacgacgaggcccagatggataccgtgaccgcggtttccggcagcggcccggcctac
ttcttcctgctcatggaggccatcgaggacgccgcgcgggacctgggtctgcccggtgag
accgcccgcctgctgaccatcgagacggcgctgggcgcggccaagatggccttggagagc
gatgagtccccggcccaattgcgccagcgggtgacctcccccgggggcaccaccgagcat
gcgctgcatgtgttggaggatggcgagtaccgcgccctgatgacccgtgcggtgcaggcc
gccgccaaacgcgcccaggagctgggccagatgctgggggagcagtga

DBGET integrated database retrieval system