KEGG   Alkalilimnicola ehrlichii: Mlg_0487Help
Entry
Mlg_0487          CDS       T00391                                 

Definition
(GenBank) malate dehydrogenase (NAD)
  KO
K00024  malate dehydrogenase [EC:1.1.1.37]
Organism
aeh  Alkalilimnicola ehrlichii
Pathway
aeh00020  Citrate cycle (TCA cycle)
aeh00270  Cysteine and methionine metabolism
aeh00620  Pyruvate metabolism
aeh00630  Glyoxylate and dicarboxylate metabolism
aeh00680  Methane metabolism
aeh00710  Carbon fixation in photosynthetic organisms
aeh01100  Metabolic pathways
aeh01110  Biosynthesis of secondary metabolites
aeh01120  Microbial metabolism in diverse environments
aeh01130  Biosynthesis of antibiotics
aeh01200  Carbon metabolism
Module
aeh_M00009  Citrate cycle (TCA cycle, Krebs cycle)
aeh_M00011  Citrate cycle, second carbon oxidation, 2-oxoglutarate => oxaloacetate
aeh_M00012  Glyoxylate cycle
aeh_M00168  CAM (Crassulacean acid metabolism), dark
Brite
KEGG Orthology (KO) [BR:aeh00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    Mlg_0487
   00620 Pyruvate metabolism
    Mlg_0487
   00630 Glyoxylate and dicarboxylate metabolism
    Mlg_0487
  09102 Energy metabolism
   00710 Carbon fixation in photosynthetic organisms
    Mlg_0487
   00680 Methane metabolism
    Mlg_0487
  09105 Amino acid metabolism
   00270 Cysteine and methionine metabolism
    Mlg_0487
Enzymes [BR:aeh01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.37  malate dehydrogenase
     Mlg_0487
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Ldh_1_N Ldh_1_C Glyco_hydro_3_C
Motif
Other DBs
NCBI-ProteinID: ABI55841
UniProt: Q0ABE6
LinkDB All DBs
Position
532854..533834
Genome map
AA seq 326 aa AA seqDB search
MKAPVRVAVTGAAGQIGYSLLFRIASGDMLGKDQPVILQLLEITPALEALKGVVMELEDC
AFPLVSGITTSDKAEEAFKDADIALLVGARPRGPGMERKDLLEANAAIFSAQGKALNDAA
SRDVKVLVVGNPANTNSLIAQRNAPDLDPRNFTAMTRLDHNRAVAQLANKTGAHNTEIKN
MIIWGNHSATQYPDISKTKVKGEAAPGLVERDWYENDFIPTVQQRGAAIIKARGASSAAS
AASSAIDHIRDWVLGTPEGEWTSMAVPSDGSYGIEKGIIYSYPCVCRNGDYEIVQDLEID
EFSREKMQATEKELVEERDAVEHLLP
NT seq 981 nt NT seq  +upstreamnt  +downstreamnt
atgaaagcacctgtgcgcgtcgcggtgaccggtgccgccggtcagattggttacagtttg
ctgttccgtatcgcttccggggacatgctgggcaaggatcagccggtgatcctgcagctg
ctggaaatcaccccggccctggaggccctgaagggggtggtgatggagctggaggactgc
gcgttcccgctggtttccgggatcaccacgtccgacaaggcggaagaggccttcaaggac
gccgacatcgccctgctggtcggcgcccgcccgcgcggcccgggtatggagcgtaaggac
ctgctggaggccaacgccgcgatcttctctgcccagggcaaggcgctgaacgatgcggcc
agccgggatgtgaaggtgctggtggtgggtaaccccgccaacaccaattcgctgattgcc
cagcgcaacgcccccgacctggatccgcgcaacttcaccgccatgacccgcctggaccat
aaccgcgcggtggcgcagctggctaacaagaccggtgcccacaacaccgagatcaagaac
atgatcatctggggcaaccactccgccacccagtacccggacatcagcaagaccaaggtc
aagggtgaggcggcgccgggcctggtcgagcgggactggtacgagaacgacttcatcccc
accgtgcagcagcgtggcgcggccatcatcaaggcgcgcggtgcctccagcgcggcctcc
gccgccagctccgccatcgaccacatccgcgactgggtgctgggcacccccgagggcgag
tggactagcatggcggtgccgtccgatggcagctacggcattgagaaggggatcatctac
tcctatccctgcgtctgccggaacggcgactacgagatcgtccaggacctggagatcgat
gagttcagccgtgagaagatgcaggccaccgagaaggagctggtcgaggagcgggacgcg
gtggaacacctgctgccctga

DBGET integrated database retrieval system