KEGG   Alkalilimnicola ehrlichii: Mlg_1121Help
Entry
Mlg_1121          CDS       T00391                                 

Definition
(GenBank) isocitrate dehydrogenase, NADP-dependent
  KO
K00031  isocitrate dehydrogenase [EC:1.1.1.42]
Organism
aeh  Alkalilimnicola ehrlichii
Pathway
aeh00020  Citrate cycle (TCA cycle)
aeh00480  Glutathione metabolism
aeh01100  Metabolic pathways
aeh01110  Biosynthesis of secondary metabolites
aeh01120  Microbial metabolism in diverse environments
aeh01130  Biosynthesis of antibiotics
aeh01200  Carbon metabolism
aeh01210  2-Oxocarboxylic acid metabolism
aeh01230  Biosynthesis of amino acids
Module
aeh_M00009  Citrate cycle (TCA cycle, Krebs cycle)
aeh_M00010  Citrate cycle, first carbon oxidation, oxaloacetate => 2-oxoglutarate
Brite
KEGG Orthology (KO) [BR:aeh00001]
 Metabolism
  Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    Mlg_1121
  Metabolism of other amino acids
   00480 Glutathione metabolism
    Mlg_1121
Enzymes [BR:aeh01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.42  isocitrate dehydrogenase (NADP+)
     Mlg_1121
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: IDH
Motif
Other DBs
NCBI-ProteinID: ABI56472
UniProt: Q0A9L5
LinkDB All DBs
Position
1312090..1314324
Genome map
AA seq 744 aa AA seqDB search
MTDTATNTIYYTLTDEAPALATRSLLPVVQTFTGAAGIDVKLSDISLAGRILSAFPERLS
DDQKVEDGLAFLGDLTQDPNANIIKLPNISASIPQLNACIRELQSQGYDVPSYPAEPKND
EEQAIHDRYAKVLGSAVNPVLREGNSDRRAPRAVKNFVRKHPHSMGKWSKASRTHADYMR
GGDFYSAEQSVTMPQAGTVRIEFVDKDGNVTLKKKLELETGEIIDSMRMSVNALRDFLEE
TMEDAKDSQVMWSLHVKATMMKVSHPIVFGHAVKVYYKEVFEKWGDLFKELGVNPNDGLS
SVYEKIETLPRSQQEEIHRDILAVYEHRPEMAMVDSYKGITNLHMPSDVIVDASMPAMIR
NGGKMWGPDGKPKDCKAVMPESTYSKIYQEMINFCKTNGAFDPTTMGTVPNVGLMAKKAE
EYGSHDKTFELEADGIMRIVDHKGHVLMQHEVEKGDIWRACQTKDIAVRDWVKLAVRRAR
EADTPAIFWLDRNRPHDIELIKKVNCYLQEHDLSGLDIRIQTYEEAIRRSMERALRGRDT
ISVTGNVLRDYLTDLFPILELGTSAKMLSIVPLLKGGGMYETGAGGSAPKHVQQLQEENH
LRWDSLGEFLAIAVSLDELGMKQDNARARVLAQCLDQATEEALENEKSPSRKTGELDNRG
SHYWLALYWAEAVAAQTEDKELADHFGPVAKQLKEKKEQILEELSVVQGSPADLDGYYHP
SPEVADKVMRPSPTLNGILADAMK
NT seq 2235 nt NT seq  +upstreamnt  +downstreamnt
atgaccgacaccgcgacgaacaccatctactacaccctcacggacgaggcccctgcgttg
gccacccgctctttactccccgtggtccagaccttcactggcgccgccggcatcgatgtc
aaactctctgatatttccctggccggacgcatcctctccgccttcccggaacggttgagc
gacgatcagaaggtggaggacggcctggccttcctcggtgacctgacgcaggaccctaac
gccaacatcatcaaactcccgaacatcagcgcctccatcccccagctcaacgcctgcatc
cgcgaactccagtcccagggctacgacgttcccagctaccccgccgagcccaagaacgac
gaggaacaggcgatccacgaccgctacgccaaggtgctgggcagcgcggtcaacccggtg
ctgcgcgagggcaactccgaccgacgcgccccccgggcggtgaagaacttcgtgcgcaag
cacccgcactccatgggcaagtggagcaaggcctcccgcacccacgccgactacatgcgc
ggcggcgacttctactccgcggagcagtccgtcaccatgccccaggccggcacggtgcgc
atcgagttcgtcgacaaggacggcaacgtcacgctgaagaagaagctggagctcgagacc
ggcgagatcatcgacagcatgcgcatgagcgtgaacgccctgcgcgacttcctggaagag
accatggaagacgccaaggactcccaggtcatgtggtcgctgcacgtgaaggccaccatg
atgaaggtctcgcaccccatcgtgttcggtcacgcggtgaaggtctactacaaagaggtc
ttcgagaagtggggcgacctgttcaaagaactgggcgtgaaccccaacgacggcctcagc
agcgtctacgagaagatcgaaaccctgccgcgctcccagcaggaggagatccaccgcgac
atcctggccgtctacgagcaccgcccggaaatggccatggtggattcctacaagggtatc
accaacctgcacatgcccagtgacgtgatcgtggacgcctccatgccggccatgatccgc
aacggcggcaagatgtgggggcccgacggcaagccgaaggactgcaaggccgtcatgccg
gagagcacctactccaagatctaccaggagatgatcaacttctgtaagaccaacggcgcc
ttcgaccccaccaccatgggcacggtgcccaacgtgggcctgatggcgaagaaggccgag
gagtacggctcccacgacaagaccttcgagctcgaggccgacggcatcatgcgcatcgtc
gaccacaagggccatgtgctgatgcagcacgaggtggagaagggcgatatctggcgcgcc
tgccagaccaaggacatcgccgtgcgcgactgggtcaagctggccgtccgccgcgcccgc
gaggccgacaccccggccatcttctggctggaccgcaaccgcccccacgacatcgagctg
atcaagaaggtcaactgctacctgcaagagcacgacctgagcggcctggatatccgcatc
cagacctacgaggaggccatccgccgctccatggagcgtgcgctgcgcggccgtgacacc
atctcggtcaccggcaacgtcctgcgcgactacctgaccgacctgttccccatcctggaa
ctgggcacctcggccaagatgctctccattgtgcccctgctcaagggcggcggcatgtac
gagaccggcgccggcggctccgcgcccaagcacgtccagcagctgcaggaggaaaaccac
ctgcgctgggattcgctgggcgagttcctggccattgcggtgtcgctggacgaactgggc
atgaagcaggacaacgcccgtgcccgcgtgctggcgcagtgcctggaccaggccaccgag
gaagcgctggagaacgagaagtcgccgtcgcgcaagaccggcgagctggacaaccggggc
agtcactactggctggccctctactgggccgaagcggttgccgctcagaccgaggacaag
gagctggccgatcacttcgggccggtggccaagcagctgaaagagaagaaggagcagatc
ctcgaagagctgagcgtggtccagggcagcccggcggacctggacggctactaccacccg
tcccccgaggtggccgacaaggtcatgcggcccagcccgacgctgaacggcatcctggcg
gacgccatgaaataa

DBGET integrated database retrieval system