KEGG   Alkalilimnicola ehrlichii: Mlg_1297Help
Entry
Mlg_1297          CDS       T00391                                 

Definition
(GenBank) phenylacetaldehyde:ferredoxin oxidoreductase
  KO
K03738  aldehyde:ferredoxin oxidoreductase [EC:1.2.7.5]
Organism
aeh  Alkalilimnicola ehrlichii
Pathway
aeh00030  Pentose phosphate pathway
aeh01100  Metabolic pathways
aeh01120  Microbial metabolism in diverse environments
aeh01200  Carbon metabolism
Brite
KEGG Orthology (KO) [BR:aeh00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00030 Pentose phosphate pathway
    Mlg_1297
Enzymes [BR:aeh01000]
 1. Oxidoreductases
  1.2  Acting on the aldehyde or oxo group of donors
   1.2.7  With an iron-sulfur protein as acceptor
    1.2.7.5  aldehyde ferredoxin oxidoreductase
     Mlg_1297
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: AFOR_C AFOR_N
Motif
Other DBs
NCBI-ProteinID: ABI56646
UniProt: Q0A941
LinkDB All DBs
Position
complement(1497224..1499074)
Genome map
AA seq 616 aa AA seqDB search
MAWAGKILRVNLTAGEISPEPLNMDWARDYLGQRGLASKYLYEEIDPACDALGPENKLIM
ATGPLTGTMASTGGRYSVVTKSPLTGAIACSNSGGFIGAEIKMAGWDMIIFEGASATPVY
LYLEDDRAELRPAETLWGKSVWDTDAELHRMHQDPELRIACVGRSAEAGCLYAGVINDLH
RAAGRSGVGTVMAAKGLKAVAVRGTRGVGNIHDPMRFLQATEQGKKILADNEVTGQGLPT
YGTQVLMNVINEMGAMPTRNMREVQFEGAHKISGEAMHEPRPTDQRPNLTTNAACFGCTI
ACGRISRIDNGHFTVEHKPKYWGNSGGLEYEAAWALGSDTGVDDLEALTYANFLCNEDGF
DPISFGATVAAAMELYENGAITDAHTDGLQLRFGSAEALSRCAELVAAGEGFGKDLGLGS
KRLCEKYGQPELSMTVKGQEFPAYDPRGIQGMGLAYATSNRGACHLRGYTVSSEVLGIPE
KTDPLTTEGKPKLVKAFQDAAAMVDSSGLCLFTTFAWTPDDIAPQIDAACGGGWDTERLL
EMGERIWNLERDFNNRAGLTGADDTLPKRLLKEAAKVGPAKGRANDLGEMLPRYYEIRGW
TPDGQVSETTRQRLRL
NT seq 1851 nt NT seq  +upstreamnt  +downstreamnt
atggcttgggcaggcaagatcctccgggtcaatctcaccgccggcgagatcagcccggaa
cccctaaacatggactgggcccgggactacctcgggcagcgcggcctggcgagcaagtat
ctctatgaggagattgaccccgcctgcgatgccctgggcccggagaacaagctgatcatg
gccaccggtccgctcaccggcaccatggcctccaccggcgggcgctactccgtcgtcacc
aagagcccgctcaccggcgccatcgcctgttccaactcggggggcttcatcggtgccgag
atcaagatggccggctgggacatgatcatcttcgagggcgcctccgctaccccggtctac
ctctacctggaggacgacagggccgagttgcgaccggcggagaccttatggggcaaatcg
gtatgggacaccgacgccgagctccaccgcatgcaccaggacccggagctgcgcatcgcc
tgtgtgggtcgatccgccgaggccggctgcctctatgcgggcgtcatcaatgacctgcac
cgcgctgccggccgctccggcgtgggcacggtgatggcggccaaggggctgaaggcggtg
gcggtacgcggcacccggggggtgggcaatatccacgacccgatgcgcttcctgcaggcc
accgaacagggcaagaagatcctcgccgacaacgaggtcaccggccaggggttgcccacc
tacggcacccaggtgctgatgaacgtcatcaacgagatgggggccatgcccacccgcaac
atgcgggaggtgcagttcgagggcgcccacaagatctccggagaggccatgcatgagccc
cggcccacggaccagcgcccgaacctcaccaccaatgccgcctgctttgggtgcaccatc
gcctgcgggcgcatcagccgcatcgacaacggccacttcaccgtcgagcacaagcccaag
tactggggtaactccggcgggctggagtacgaggcggcctgggccctgggctcggacacc
ggtgtggacgacctggaggcgctgacctacgccaatttcctctgcaatgaggatggcttc
gatcccatctccttcggcgccaccgtcgccgccgccatggagctctacgagaacggggcc
atcaccgatgcccacacggacgggctgcaattgaggtttggctcggccgaggcgctgagc
cgctgtgccgagctggtggccgccggggagggctttggcaaggacctgggcctgggctcg
aaacggctctgcgagaagtacggccaaccggaactgtcgatgacggtaaagggccaagag
tttccggcctacgacccgcgcggcattcagggcatggggctggcctacgccacctccaac
cggggtgcctgccacctccgcggctataccgtctcctccgaggtgctgggtatccccgag
aagaccgatccgctcaccaccgagggcaaaccgaagctggtgaaggccttccaggacgcg
gccgccatggtggactcctccgggctgtgcctgttcaccaccttcgcctggacccccgac
gacattgccccgcagatcgacgccgcctgcggcggcggctgggacaccgagcggttgctg
gagatgggcgaacggatctggaacctggagcgtgacttcaacaaccgcgccggtctgacc
ggggcggacgacaccctgcccaaacgcctgctcaaggaggcggcgaaagtcgggccggcc
aagggccgggccaacgacctgggcgagatgctgccccgctattacgagatccgcggctgg
acaccggacggccaggttagcgagaccacccgtcagcgactgcgcctgtag

DBGET integrated database retrieval system