KEGG   Alkalilimnicola ehrlichii: Mlg_2379Help
Entry
Mlg_2379          CDS       T00391                                 

Definition
(GenBank) Enoyl-[acyl-carrier-protein] reductase (NADH)
  KO
K00208  enoyl-[acyl-carrier protein] reductase I [EC:1.3.1.9 1.3.1.10]
Organism
aeh  Alkalilimnicola ehrlichii
Pathway
aeh00061  Fatty acid biosynthesis
aeh00780  Biotin metabolism
aeh01100  Metabolic pathways
aeh01130  Biosynthesis of antibiotics
aeh01212  Fatty acid metabolism
Module
aeh_M00083  Fatty acid biosynthesis, elongation
aeh_M00572  Pimeloyl-ACP biosynthesis, BioC-BioH pathway, malonyl-ACP => pimeloyl-ACP
Brite
KEGG Orthology (KO) [BR:aeh00001]
 09100 Metabolism
  09103 Lipid metabolism
   00061 Fatty acid biosynthesis
    Mlg_2379
  09108 Metabolism of cofactors and vitamins
   00780 Biotin metabolism
    Mlg_2379
  09110 Biosynthesis of other secondary metabolites
   00333 Prodigiosin biosynthesis
    Mlg_2379
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01004 Lipid biosynthesis proteins [BR:aeh01004]
    Mlg_2379
Enzymes [BR:aeh01000]
 1. Oxidoreductases
  1.3  Acting on the CH-CH group of donors
   1.3.1  With NAD+ or NADP+ as acceptor
    1.3.1.9  enoyl-[acyl-carrier-protein] reductase (NADH)
     Mlg_2379
    1.3.1.10  enoyl-[acyl-carrier-protein] reductase (NADPH, Si-specific)
     Mlg_2379
Lipid biosynthesis proteins [BR:aeh01004]
 Fatty acid synthase
  Component type
   Mlg_2379
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: adh_short_C2 adh_short
Motif
Other DBs
NCBI-ProteinID: ABI57719
UniProt: Q0A618
LinkDB All DBs
Position
complement(2702341..2703117)
Genome map
AA seq 258 aa AA seqDB search
MTQPFLSLAGKKGLVVGIANDQSIAYHCGRAFRELGAELAVTYLNEKAEKHVRPLAEELQ
APIVMPCNVQQEGELGAVFQAIEAQWGRLDFVVHSIAFAPLRDLHGRLTDSSVDGFLTAM
DVSCHSFIRMARLAEPLMDQGGTLLTMSYYGAEKVIPGYQLMGPAKAALECSVRYLADEL
GGKGIRVHGLSPGPMDTRAASGLAGFDHLMETARSRSPLRCLAEPGDVGALAALLVSDQA
RTLTGTLIPVDGGYHVTG
NT seq 777 nt NT seq  +upstreamnt  +downstreamnt
atgacgcagccgttcctgtccctggccggcaaaaaaggcctggtggtcggtatcgccaac
gaccagagcatcgcctaccactgcgggcgggccttccgggagctgggcgctgagctggcg
gtcacctacctgaatgaaaaggcggagaagcacgtccggccgttggccgaggaactgcag
gcgcccatcgttatgccttgcaatgtgcagcaggagggcgagctgggggccgtgttccag
gccatcgaggcgcagtggggccggctggatttcgtggtccactccattgccttcgcgccc
ctgcgggacctgcacggccggctcaccgactcatccgtggacggctttctcaccgccatg
gacgtctcctgccattccttcattcgcatggcgcgcctggccgagccgctgatggaccag
ggcgggaccctgctcaccatgagctattacggggccgagaaggtcatccccggctaccag
ctgatgggcccggccaaggcggcgctggagtgcagcgtccgctacctggcggacgagctg
ggcggcaagggcatccgcgtgcatggcctgtcgccgggccccatggacacccgcgccgcc
tccggtctggccggctttgaccacctcatggagaccgcgcgcagtcgctcaccgctgcgc
tgcctggccgagccgggcgatgtgggtgcgctggccgcactgctggtcagcgaccaggcc
cgtacccttactggcaccctcatcccggtggacggcggctaccacgtcaccggctga

DBGET integrated database retrieval system