KEGG   Alkalilimnicola ehrlichii: Mlg_2553Help
Entry
Mlg_2553          CDS       T00391                                 

Definition
(GenBank) ATP dependent DNA ligase
  KO
K07468  putative ATP-dependent DNA ligase [EC:6.5.1.1]
Organism
aeh  Alkalilimnicola ehrlichii
Brite
Enzymes [BR:aeh01000]
 6. Ligases
  6.5  Forming phosphoric-ester bonds
   6.5.1  Ligases that form phosphoric-ester bonds (only sub-subclass identified to date)
    6.5.1.1  DNA ligase (ATP)
     Mlg_2553
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: RNA_ligase PucR
Motif
Other DBs
NCBI-ProteinID: ABI57893
UniProt: Q0A5J4
LinkDB All DBs
Position
2895909..2897009
Genome map
AA seq 366 aa AA seqDB search
MDALTAKTALEKGKASRHEFEGLHYIRLHDSVARLPKGSVRLDDGTVVPGYPSIGRIQAL
GPGLAKQYGDELFWAEEKIDGFNIRILAHQGRLLAFSRGGYLCPFSTDRVPELLDPTLFD
DHPGLILCAELAGPENPYMEGSPPHVTEDVALFVFDIRRAGANGFLPQEEKLALAERYRL
PLARVFGRYRADDQQALHALILELDEAGCEGLVFKGETRGARSKYVTARSNITDIALVSD
ALLDLPPEYFTHRLMRLALFESEHRGDDTALEQELGRALLRGLGRAVERSRSVGRVGHRY
RCRFREKRNLEHFVAHLEATGGPQHVKILYQPTHQEDGYWVLEFERVLPRMTGTLAHSLS
GGAQFD
NT seq 1101 nt NT seq  +upstreamnt  +downstreamnt
atggacgcactcaccgcgaagaccgcgttggagaagggtaaggccagtcggcacgagttc
gagggcctgcactacatccggctgcacgacagcgtggcccggctgcccaagggcagcgtg
cgactcgacgatggcaccgtcgtcccgggctacccctccatcggccgcatccaggccctg
ggccccggtctggcgaagcaatacggtgatgagctcttctgggcggaagagaagatcgat
ggcttcaacatccgcatcctcgcccaccagggccggctgctggccttcagccgcggcggg
tatctctgcccgttcagcaccgaccgcgttcccgagctgcttgaccccaccctgttcgac
gaccacccggggctgatcctgtgtgccgagttggcagggccggagaacccctacatggaa
ggcagcccgccccacgtcaccgaggacgtggccctgttcgtcttcgacatccggcgcgcc
ggtgccaacggcttcctcccgcaggaggagaagctggccctggccgagcgctaccggctg
cccctggcccgggtctttggtcgctaccgggccgacgaccagcaggcgctgcacgccttg
atcctggaactggatgaggccggctgtgaaggcctggtgttcaagggcgagacacgcggg
gcacgcagcaagtacgtcaccgcccggtccaatatcaccgatatcgccctggtcagcgac
gccctgctcgacctgccaccggagtacttcacccaccgcctgatgcgcttggcgctgttc
gagagtgagcaccgcggcgacgacacggcgctggaacaggagctgggccgggccctgctc
cggggcctcggccgggcggtggagcgcagccgcagcgtgggccgggtcggtcaccgctac
cgctgccgattccgcgagaagcgcaacctggagcacttcgtcgcccacctggaggccacc
ggcggcccgcagcacgtcaagatcctctaccagcccacgcaccaggaggacggctactgg
gtgctggagtttgagcgcgtgctgccgcggatgaccggtaccctggcccacagcctttcc
ggcggcgcccagttcgactga

DBGET integrated database retrieval system