KEGG   Alkalilimnicola ehrlichii: Mlg_2836Help
Entry
Mlg_2836          CDS       T00391                                 

Definition
(GenBank) ribulose-1,5-bisphosphate carboxylase/oxygenase large subunit
  KO
K01601  ribulose-bisphosphate carboxylase large chain [EC:4.1.1.39]
Organism
aeh  Alkalilimnicola ehrlichii
Pathway
aeh00630  Glyoxylate and dicarboxylate metabolism
aeh00710  Carbon fixation in photosynthetic organisms
aeh01100  Metabolic pathways
aeh01120  Microbial metabolism in diverse environments
aeh01200  Carbon metabolism
Module
aeh_M00166  Reductive pentose phosphate cycle, ribulose-5P => glyceraldehyde-3P
Brite
KEGG Orthology (KO) [BR:aeh00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00630 Glyoxylate and dicarboxylate metabolism
    Mlg_2836
  09102 Energy metabolism
   00710 Carbon fixation in photosynthetic organisms
    Mlg_2836
Enzymes [BR:aeh01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.1  Carboxy-lyases
    4.1.1.39  ribulose-bisphosphate carboxylase
     Mlg_2836
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: RuBisCO_large RuBisCO_large_N
Motif
Other DBs
NCBI-ProteinID: ABI58176
UniProt: Q0A4R1
LinkDB All DBs
Position
3219578..3220999
Genome map
AA seq 473 aa AA seqDB search
MSSKSYSAGVKDYRDTYWEPDYQVKDSDFLACFKVVPQAGVPREEAAAAVAAESSTGTWT
TVWTDLLTDLDYYKGRAYKIEDVPGDDEAFYAFIAYPIDLFEESSVVNVFTSLVGNVFGF
KAVRSLRLEDVRIPLAYVMTCNGPPHGIQVERDKMDKYGRGLLGCTIKPKLGLSAKNYGR
AVYECLRGGLDFTKDDENVNSQPFMRWRDRFLFVQEATEKAQQETGERKGHYLNVTAPSP
EEMYERAEFAKEIGAPIIMHDFLTGGFCANTGLARWCRKNGMLLHIHRAMHAVMDRNPRH
GIHFRVLAKALRLSGGDHLHTGTVVGKLEGDRAATEGWIDLLRERFIPEDRARGIFFDQD
WGAMPGVFAVASGGIHVWHMPALVSIFGDDAVFQFGGGTLGHPWGNAAGAAANRVALEAC
VKARNEGRNLEREGKEILQAAAQHSPELKIAMETWKEIKFEFETVDKLDTTHR
NT seq 1422 nt NT seq  +upstreamnt  +downstreamnt
atgtccagcaaaagctattcagcaggcgtcaaagattatcgcgatacctattgggagccc
gactaccaggtcaaggacagtgacttcctggcctgtttcaaggtcgtgccgcaggccggc
gtgccccgtgaggaggccgccgccgccgtggccgccgagtcctccaccggcacctggacc
accgtgtggacggacctgctgacggacctggattattacaagggccgtgcctacaagatc
gaggacgtgcccggcgacgacgaagccttctacgcctttattgcctaccccatcgacctg
ttcgaagagagctcggtggtcaatgtcttcacctccctggtgggcaacgtcttcggcttc
aaggccgtgcgcagcctgcgcctggaggacgtgcgcatcccgctggcctatgtgatgacc
tgcaacggcccgccccacggcatccaggtggagcgggacaagatggacaagtacggccgc
ggcctgctcggctgcaccatcaagcccaagctcggtctgtccgccaagaactatggccgt
gcggtctacgagtgcctgcgcggtggcctggacttcaccaaggacgacgaaaacgtcaac
tcccagcccttcatgcgctggcgcgaccgcttcctgttcgtccaggaggccaccgagaag
gcgcagcaggagaccggcgagcgcaagggccactacctgaacgtcaccgccccctcgcct
gaggagatgtacgagcgcgcggagttcgccaaggagatcggtgccccgatcatcatgcac
gacttcctcaccggcggcttctgcgccaacaccggcctcgcccgctggtgccgcaagaac
ggcatgctgctgcacatccaccgcgccatgcacgcggtgatggaccgcaacccgcgccac
ggcatccacttccgggtcctggccaaggccctgcgcctgagcggcggcgaccacctgcac
accggcaccgtggtgggcaagctggagggcgaccgcgccgccaccgagggctggatcgac
ctgctgcgtgaacgctttatccccgaggaccgggcccgcggcatcttcttcgatcaggac
tggggcgccatgcccggcgtcttcgcggtggcctccggtggtatccacgtctggcacatg
ccggcgctggtctccatcttcggcgacgatgccgtcttccagttcggcggcggcaccctg
ggccacccttggggcaacgcggccggcgccgcggccaaccgggtggcgctcgaggcctgc
gtcaaggcgcgcaacgagggccgcaacttggagcgggaaggcaaggagatcctgcaggcc
gctgcccagcacagccccgagctgaagatcgccatggagacctggaaggagatcaagttc
gaattcgagacggtggacaagctggacacgacgcaccgctaa

DBGET integrated database retrieval system