KEGG   Acinetobacter equi: AOY20_04745Help
Entry
AOY20_04745       CDS       T04103                                 

Definition
(GenBank) D-alanine--D-alanine ligase
  KO
K01921  D-alanine-D-alanine ligase [EC:6.3.2.4]
Organism
aei  Acinetobacter equi
Pathway
aei00473  D-Alanine metabolism
aei00550  Peptidoglycan biosynthesis
aei01100  Metabolic pathways
aei01502  Vancomycin resistance
Brite
KEGG Orthology (KO) [BR:aei00001]
 09100 Metabolism
  09106 Metabolism of other amino acids
   00473 D-Alanine metabolism
    AOY20_04745
  09107 Glycan biosynthesis and metabolism
   00550 Peptidoglycan biosynthesis
    AOY20_04745
 09160 Human Diseases
  09175 Drug resistance: antimicrobial
   01502 Vancomycin resistance
    AOY20_04745
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01011 Peptidoglycan biosynthesis and degradation proteins [BR:aei01011]
    AOY20_04745
Enzymes [BR:aei01000]
 6. Ligases
  6.3  Forming carbon-nitrogen bonds
   6.3.2  Acid-D-amino-acid ligases (peptide synthases)
    6.3.2.4  D-alanine---D-alanine ligase
     AOY20_04745
Peptidoglycan biosynthesis and degradation proteins [BR:aei01011]
 Precursor biosynthesis
  Amino acid ligase
   AOY20_04745
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Dala_Dala_lig_C Dala_Dala_lig_N CPSase_L_D2 ATP-grasp ATP-grasp_4 RimK ATP-grasp_3 ATPgrasp_YheCD GARS_A TTL
Motif
Other DBs
NCBI-ProteinID: ALH94896
UniProt: A0A0N9V6Q3
LinkDB All DBs
Position
1016847..1017776
Genome map
AA seq 309 aa AA seqDB search
MTNASKFGKVAVLFGGKSAEREVSLDSGKAVLEALLRSGVNAEGFDPKEQSITDLKQYDR
AFIVLHGRGGEDGQIQGALEWLDIPYTGTGVQGSAIGMDKVKTKQVWQGSELPTAPYRIV
TKDSDLQEIVDSIGLPFIIKPVHEGSSIGMSKVEKMEDFATAIEKATQHDAIVMAEKWIT
GREFTIVVLNGQALPVIRLQPPEDVAFYDYEAKYNRNDVQYGIPCGLTEEEEKRLQALSL
RAFQAVGASGWGRIDAMQDHDGNFWLLEVNTVPGMTSHSLVPKAAQAVGYNFDELCVAIL
EQTLTEVAH
NT seq 930 nt NT seq  +upstreamnt  +downstreamnt
gtgacaaatgcttctaagttcggcaaagttgccgtgttgtttggtggtaaatctgctgaa
cgtgaggtgtcattagacagtggtaaagctgtacttgaagcattgcttcgctcaggggta
aatgccgaaggttttgatcctaaagagcaaagtattactgatctaaaacagtacgatcgc
gcatttattgtattgcatggtcgtggtggagaagatggtcaaattcaaggtgcgcttgaa
tggcttgatattccttatacaggtacaggtgtccaaggttcagcaattggaatggataag
gtcaaaactaaacaggtttggcaaggttcagaattaccaacagcaccgtatcgtattgtt
acaaaagattcagatttacaagaaattgtagattctattggcttaccttttatcattaaa
ccagtacatgaaggttcaagtattggtatgagtaaagttgagaaaatggaagactttgcg
actgcaattgaaaaagcaacccaacatgacgcgattgtaatggctgaaaaatggattaca
ggtcgtgaatttacgattgttgttcttaatggccaagcacttcctgttattcgcttacaa
ccaccagaagatgttgcattttacgattatgaagcaaaatataatcgtaatgacgtgcag
tatggtattccatgtggcttaactgaagaggaagaaaaacgtcttcaagcattaagttta
agagctttccaagcagttggagcaagtggttgggggcgtatcgatgccatgcaggatcat
gacggtaatttttggttgttagaagtgaatactgtaccaggaatgacgagtcactcatta
gtaccaaaagctgcacaagctgtaggttataattttgacgaattatgtgtggcaattctt
gagcaaacattaacggaagtggcacactaa

DBGET integrated database retrieval system