KEGG   Acinetobacter equi: AOY20_08465Help
Entry
AOY20_08465       CDS       T04103                                 

Definition
(GenBank) phosphate ABC transporter ATP-binding protein
  KO
K02036  phosphate transport system ATP-binding protein [EC:7.3.2.1]
Organism
aei  Acinetobacter equi
Pathway
aei02010  ABC transporters
Brite
KEGG Orthology (KO) [BR:aei00001]
 09130 Environmental Information Processing
  09131 Membrane transport
   02010 ABC transporters
    AOY20_08465
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:aei02000]
    AOY20_08465
Enzymes [BR:aei01000]
 7. Translocases
  7.3  Catalysing the translocation of inorganic anions and their chelates
   7.3.2  Linked to the hydrolysis of a nucleoside triphosphate
    7.3.2.1  ABC-type phosphate transporter
     AOY20_08465
Transporters [BR:aei02000]
 ABC transporters, prokaryotic type
  Phosphate and amino acid transporters
   Phosphate transporter
    AOY20_08465
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ABC_tran AAA_21 SMC_N RsgA_GTPase AAA_15 AAA_33 AAA_22 Rad17 AAA_29 AAA_18 AAA_28 PRK AAA_16 RNA_helicase G-alpha AAA_23 AAA_24 MMR_HSR1 NACHT
Motif
Other DBs
NCBI-ProteinID: ALH95557
UniProt: A0A0N9VEG2
LinkDB All DBs
Position
1778300..1779220
Genome map
AA seq 306 aa AA seqDB search
MNMVTATETNSLKQDKSVNSEKIQSSSAESEKMASTSFISQFDTQPAMKKDIPTSNIKLS
TSDVHVYYGESEAIKGIDLNIYENEVIAFIGPSGCGKSTFLRTLNRMNDTIDSCRVTGKV
LLDQQDIYDPNLDVVLLRAQVGMVFQKPNPFPKSIFDNVAYGPKLHGLARDKYDLEEIVE
NSLRKAGLWDEVKYRLNQPGTGLSGGQQQRLCIARTIAVSPEVILMDEPCSALDPIATAK
VEELISELSTQYTIAIVTHSMQQAARVSDRTAYFHLGDLIEVNATEKVFTQPDHQLTEAY
ITGRFG
NT seq 921 nt NT seq  +upstreamnt  +downstreamnt
atgaatatggtaactgcaacagaaacaaattccttaaaacaggataaatcagtgaattca
gaaaaaatacagtcaagctctgctgaatctgagaaaatggcatcaacatcatttatttct
caatttgatacacagccagcaatgaaaaaagatatacctacttcaaatatcaaattaagt
acttcagatgtgcatgtttattatggggagtctgaagcgattaaaggcatagatttaaat
atctatgaaaatgaagtgattgcttttattggtccatcaggctgtggtaaatcaacattt
ttaagaacattgaatcgcatgaatgatacgatcgattcatgtcgtgtgactgggaaagtt
ttgttagatcaacaagatatatatgatcctaatttagatgtagtcttgttacgtgctcaa
gtaggcatggttttccaaaagccaaatccttttcctaagtctatttttgataatgtagct
tatggtccaaaattacatggattggcacgtgataaatatgatttagaagaaattgttgaa
aatagtcttcgtaaagcggggctatgggatgaagtaaaatatcgtttaaatcagccagga
acaggactttcaggtgggcagcaacaacgactatgtattgcacgtacaattgcagtgagc
cctgaagtaattttaatggatgagccgtgctcggcattagatcctattgcaacagctaaa
gttgaagagctaatttctgaactttctacgcaatatacaatcgcaattgtaactcactca
atgcaacaagcagcacgtgtttctgatcgaactgcatattttcatttaggggatttaatt
gaagtaaatgcaacagaaaaagtatttactcagccagatcatcagcttacggaagcctat
attacggggcgctttggttaa

DBGET integrated database retrieval system