KEGG   Acinetobacter equi: AOY20_08850Help
Entry
AOY20_08850       CDS       T04103                                 

Definition
(GenBank) NADH dehydrogenase
  KO
K03387  NADH-dependent peroxiredoxin subunit F [EC:1.8.1.-]
Organism
aei  Acinetobacter equi
Brite
KEGG Orthology (KO) [BR:aei00001]
 09190 Not Included in Pathway or Brite
  09191 Unclassified: metabolism
   99980 Enzymes with EC numbers
    AOY20_08850
Enzymes [BR:aei01000]
 1. Oxidoreductases
  1.8  Acting on a sulfur group of donors
   1.8.1  With NAD+ or NADP+ as acceptor
    1.8.1.-  
     AOY20_08850
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Pyr_redox_2 Pyr_redox_3 Pyr_redox Thioredoxin_3 GIDA FAD_binding_2 DAO HI0933_like FAD_oxidored FAD_binding_3 Thi4 AlaDh_PNT_C K_oxygenase FMO-like Cytochrom_C_2 Spermine_synth Glutaredoxin
Motif
Other DBs
NCBI-ProteinID: ALH95626
UniProt: A0A0N9W3L8
LinkDB All DBs
Position
1857553..1859118
Genome map
AA seq 521 aa AA seqDB search
MLDQNTSAQLKALLERLEGPIELVATLDASDKSTKIKELVEEIAALSNLVTARFDGKNKR
APSFGVAKAGEEPRVFFAGLPMGHEFTSLILALLQTSGYAPKVSDEVLASIKGLGIKSDF
DVFVSLSCHNCPDVVQALNLIAIYNPGTTATMIDGAFFQDEVEERKIMAVPMVFQDNEHI
GQGRMTLEEIVAKLDTNSAAKDAEKLNAKEAFDVLVIGGGPAGNTSAIYAARKGIRTGIV
AERMGGQVMDTMDIENFTSVQKTQGPKFAAEMEAHVREYGVDIMNLQRVSDIKGADQTAN
GLVEVTLENGAKLESKTVILSTGARWREMNVPGEQEYRTRGVAYCPHCDGPLFKGKRVAV
IGGGNSGVEAAIDLAGIVEHVTLVEFDTKLRADQVLQDKLNSLPNTTVIKNALSTEVVGD
GSQVTALKYKDRATDEIKSIELAGIFVQIGLLPNTDFLKETAVELSNRGEIVINERNETN
VKGVFAAGDCTTVPYKQIIIATGEGAKASLSAFDYIIRSGQ
NT seq 1566 nt NT seq  +upstreamnt  +downstreamnt
atgttagatcaaaatacttcagctcaattaaaagctcttttagaacgccttgaaggtcct
atcgaattagttgcaactttagatgcatcagacaaatctacaaaaattaaagaacttgta
gaagaaattgctgcactttcaaatttagtaactgctcgttttgatggtaaaaataaacgt
gcaccaagctttggtgttgcaaaagcaggtgaagaaccacgtgtattctttgcaggctta
ccaatggggcatgaatttacatctttgatcttagcattgttacaaacttctggttatgca
cctaaagtatctgatgaagtattagcttctatcaaaggcttaggcattaaatctgatttt
gatgtatttgtatctttaagctgccataactgtccagatgttgtacaagcattaaactta
attgcaatttataaccctggtacaactgcaactatgattgatggtgcattcttccaagat
gaagttgaagaacgcaaaatcatggctgtaccaatggtattccaagacaatgaacacatt
ggtcaaggtcgtatgactttggaagagattgttgcaaaattagatactaattctgctgct
aaagatgctgaaaagttaaatgcaaaagaagcatttgatgtacttgtgattggtggtgga
cctgcagggaatacttctgcaatctatgctgcacgtaaaggtatccgtacaggtatcgtt
gctgagcgcatgggtggtcaagttatggatactatggatatcgaaaacttcacatcggtg
cagaagactcaaggtcctaaatttgctgctgaaatggaagcacacgtacgtgaatacggc
gtagatatcatgaacttacaacgtgtatctgatattaagggtgcagatcaaacagcaaat
ggtttggtagaagtaactttagaaaatggtgcgaaactagaatctaagacagttattctt
tcaactggtgctcgttggagagaaatgaatgttcctggtgagcaagaataccgtacacgt
ggtgttgcatactgcccacactgtgatggtccattgttcaaaggtaaacgtgttgctgta
attggtggtggtaactctggtgttgaagctgcaattgaccttgctggtattgttgagcat
gtaacattggttgagtttgatactaaattacgtgctgaccaagttcttcaagataaattg
aatagcttaccaaacacaactgtaatcaaaaatgcattatctacagaagtggttggtgat
ggttcacaagtaacagcacttaaatataaagatcgtgcaactgatgaaattaaatcaatt
gaacttgctggtatctttgtccaaattggtttgttaccaaacactgatttcttaaaagaa
acagcagttgagctttcaaaccgtggtgagattgtaatcaatgaacgtaatgaaacaaat
gtaaaaggtgtatttgcagcaggtgactgtacaacagttccttataaacaaatcatcatt
gcaacaggtgaaggcgctaaagcatcactttcagcatttgattacattatccgttcaggt
caataa

DBGET integrated database retrieval system