KEGG   Acinetobacter equi: AOY20_14235Help
Entry
AOY20_14235       CDS       T04103                                 

Definition
(GenBank) superoxide dismutase
  KO
K04564  superoxide dismutase, Fe-Mn family [EC:1.15.1.1]
Organism
aei  Acinetobacter equi
Brite
Enzymes [BR:aei01000]
 1. Oxidoreductases
  1.15  Acting on superoxide as acceptor
   1.15.1  Acting on superoxide as acceptor (only sub-subclass identified to date)
    1.15.1.1  superoxide dismutase
     AOY20_14235
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Sod_Fe_C Sod_Fe_N
Motif
Other DBs
NCBI-ProteinID: ALH96610
UniProt: A0A0N9VB37
LinkDB All DBs
Position
3025050..3025676
Genome map
AA seq 208 aa AA seqDB search
MTAITLPALPYGYEDLAPHISKETLEFHHDKHHNTYVVNLNNLIKGTDLEDKTLEEIIKA
SAGDASKAGIFNNAAQVWNHTFYWNCMAKNGGGKATGALAAKIDEAFGSYEKFAEEFAAA
ATTQFGSGWAWLVADKVNGNLSILKTSNADTPLAHGKVAVLTIDVWEHAYYIDFRNARPK
YITTFLESLVNWDYANAKYAGLAAGVEK
NT seq 627 nt NT seq  +upstreamnt  +downstreamnt
atgacagcgattactttacccgctttaccttacggctacgaagatttagctccacatatc
agcaaagaaactttagagttccatcatgacaagcaccacaacacttacgtggttaacttg
aacaacttgattaaaggcacagatcttgaagataaaactttagaagaaatcattaaagct
tcagctggtgatgcatctaaagcaggtattttcaacaatgctgctcaagtttggaaccac
actttctattggaactgtatggctaaaaatggtggcggtaaagcaactggtgctttagct
gctaaaattgatgaagcatttggttcttatgaaaaatttgctgaagagtttgctgctgct
gcaacaactcaattcggttcaggttgggcttggttagttgctgacaaagtaaatggtaac
ctttctattcttaaaacttcaaatgctgatactccacttgctcatggcaaagttgctgta
ttaacaattgacgtatgggaacacgcttactacatcgacttccgtaatgctcgtcctaaa
tacatcacaactttcttagaaagccttgtgaactgggattatgcaaacgctaaatatgca
ggtcttgctgctggcgttgaaaaataa

DBGET integrated database retrieval system