KEGG   Aeromonas encheleia: NCTC12917_02252
Entry
NCTC12917_02252   CDS       T06531                                 

Gene name
ddl
Definition
(GenBank) D-alanyl-alanine synthetase A
  KO
K01921  D-alanine-D-alanine ligase [EC:6.3.2.4]
Organism
ael  Aeromonas encheleia
Pathway
ael00473  D-Alanine metabolism
ael00550  Peptidoglycan biosynthesis
ael01100  Metabolic pathways
ael01502  Vancomycin resistance
Brite
KEGG Orthology (KO) [BR:ael00001]
 09100 Metabolism
  09106 Metabolism of other amino acids
   00473 D-Alanine metabolism
    NCTC12917_02252 (ddl)
  09107 Glycan biosynthesis and metabolism
   00550 Peptidoglycan biosynthesis
    NCTC12917_02252 (ddl)
 09160 Human Diseases
  09175 Drug resistance: antimicrobial
   01502 Vancomycin resistance
    NCTC12917_02252 (ddl)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01011 Peptidoglycan biosynthesis and degradation proteins [BR:ael01011]
    NCTC12917_02252 (ddl)
Enzymes [BR:ael01000]
 6. Ligases
  6.3  Forming carbon-nitrogen bonds
   6.3.2  Acid-D-amino-acid ligases (peptide synthases)
    6.3.2.4  D-alanine---D-alanine ligase
     NCTC12917_02252 (ddl)
Peptidoglycan biosynthesis and degradation proteins [BR:ael01011]
 Precursor biosynthesis
  Amino acid ligase
   NCTC12917_02252 (ddl)
SSDB
Motif
Pfam: Dala_Dala_lig_C Dala_Dala_lig_N ATP-grasp CPSase_L_D2 ATPgrasp_ST
Other DBs
NCBI-ProteinID: VEG96679
UniProt: A0A3S4WWR2
LinkDB
Position
1:complement(2416011..2417000)
AA seq 329 aa
MKNMHVLLLCGGGGAEHEVSLRSATFLEQQLALLPNVEVTRVEMFADRWLSADGRECKLG
LDKLLSFDSVARPVDYVVPCIHGYPGETGDLQSFLELAGLPYLGCDAEASKICFNKISTK
LWFSALGIPNTPYLFLTEQDEAGIAEAKAALAKWGKVFIKAASQGSSVGCYSASNEAELV
QGIKDAFGYSEQVLIEKAVKPRELEVAVYQYGDELVATYPGEICVPTDKFYTYEEKYSSA
SHTETALHAEGLTQAQSDAIQAYALKAFRQLKLTHLSRIDFFLTEEGEILLNEINTFPGM
TSISMFPKLLEHHGHSFARFLEQILRKPA
NT seq 990 nt   +upstreamnt  +downstreamnt
atgaagaacatgcatgttttgctgctgtgcggcggcggtggcgccgaacacgaagtctct
ctgcgtagtgccactttcctcgagcaacaactcgccctcctgcccaatgtcgaagtgacc
cgggtcgagatgtttgccgatcgctggctcagtgccgacggccgcgagtgcaagctgggg
ctggacaagctgctctccttcgacagcgtggcccgcccggtggattacgtggtgccctgc
atccacggctaccctggcgagaccggcgatctgcaatccttcctcgagctggcgggcctg
ccttatctgggttgcgacgccgaggcgagcaagatctgcttcaacaagatcagcaccaag
ctgtggttctccgccctcggtatccccaacaccccctatctgttcctgaccgagcaggat
gaggcggggatcgccgaggcgaaagccgccctcgccaagtggggcaaggtgttcatcaag
gccgcctctcagggctcctccgttggctgctactccgccagcaacgaagccgagctggtg
cagggcatcaaggacgccttcggttactccgagcaggtgctgatcgagaaggcagtcaag
ccgcgcgagctggaagtggctgtctatcagtacggtgacgagctggtggcgacctatccg
ggcgagatctgcgtgccgaccgacaagttctacacctacgaagagaagtacagcagcgcc
agccacaccgagaccgccctgcatgcggaaggcctgacccaggctcagtctgatgccatc
caggcctatgccctcaaggcattccgtcagctgaagttgacccatctgtcgcgcatcgac
ttcttcctgaccgaggagggggagatactgctcaacgagatcaacaccttccctggcatg
acctccatctccatgttcccgaaactgctggagcatcacggtcacagcttcgcccgcttc
ctcgagcagatcctgcgcaagcccgcctga

DBGET integrated database retrieval system