KEGG   Aeromonas encheleia: NCTC12917_03234
Entry
NCTC12917_03234   CDS       T06531                                 

Gene name
ygdH
Definition
(GenBank) lysine decarboxylase family protein
  KO
K06966  pyrimidine/purine-5'-nucleotide nucleosidase [EC:3.2.2.10 3.2.2.-]
Organism
ael  Aeromonas encheleia
Pathway
ael00230  Purine metabolism
ael00240  Pyrimidine metabolism
ael01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:ael00001]
 09100 Metabolism
  09104 Nucleotide metabolism
   00230 Purine metabolism
    NCTC12917_03234 (ygdH)
   00240 Pyrimidine metabolism
    NCTC12917_03234 (ygdH)
Enzymes [BR:ael01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.2  Hydrolysing N-glycosyl compounds
    3.2.2.10  pyrimidine-5'-nucleotide nucleosidase
     NCTC12917_03234 (ygdH)
    3.2.2.-  
     NCTC12917_03234 (ygdH)
SSDB
Motif
Pfam: DUF3412 DUF4478 Lysine_decarbox LDcluster4 Glycos_transf_2
Other DBs
NCBI-ProteinID: VEG97627
UniProt: A0A3S4UE05
LinkDB
Position
1:3505340..3506695
AA seq 451 aa
MITHINPVGSMDLLSQLEVDRLKQTASSDIYQLFRNCSLAVLNSGSHTDSSKEILERFKS
FDIHVIRRERGVKLELFNAPEHAFVDGEIIRGIQEHLFSVLRDILYVSAQLESNRQVNLT
NATHLSNLVFAILRNAKAILPGADPNLVVCWGGHSINEIEYQYTRSVGSELGLRELNICT
GCGPGAMEGPMKGAAVGHAKQRVRNGRYVGLTEPSIIAAEPPNPIVNELVILPDIEKRLE
AFVRLGHGIIIFPGGVGTAEELLYLLGIMMHPANERQPIPIILTGPKESADYFRAIDDFV
KATLGEPATRLYRIIIGDAPEVARVMKEAMPKIREYRKSVGDAYSFNWSLRIEPEFQLPF
EPDHASMASLDLHRNQPPQLLAANLRRAFSGIVAGNVKEGGIRAIEKKGPFKLHGDKELM
HLMDRLLESFVRQQRMKLPGSQYIPCYEIVK
NT seq 1356 nt   +upstreamnt  +downstreamnt
atgattacgcacatcaatcctgtcggcagcatggacttgctgtcccaactcgaggtggat
cgcctcaagcagaccgcctccagcgatatctatcaactgtttcgcaactgctcgctggcg
gtgctcaactccggcagccacaccgacagctccaaagagatactggagcgcttcaagtct
ttcgacattcatgtgatccggcgcgagcgcggggtcaaactcgagctgttcaatgcaccc
gagcacgccttcgtcgatggcgagatcatccgcggcatccaggagcatctgttctccgtg
ctgcgggacatcctctacgtctcggcccagctggagtcgaaccgccaggtcaatctgacc
aacgccacccacctctccaacctggtgttcgccatactgcgcaacgccaaggcgatcctg
ccgggggcggatcccaacctggtagtgtgctggggcggccactccatcaacgagatcgag
taccagtacacccgctcggtgggcagtgagctggggctgagggagctgaacatctgcacc
ggttgcggcccgggcgccatggagggtcccatgaagggggccgccgtcggccacgccaag
cagcgggtacgcaacggccgctatgtcggcctcaccgagccgtccatcatcgccgccgag
ccgcccaaccccatcgtcaacgagctggtgatcctgccggacatcgagaagcggctggag
gccttcgtacgcctgggccacggcatcatcatcttccccggtggggtcggtaccgccgag
gagctgctctacctgctcggcatcatgatgcacccggccaacgagcgccaacccatcccc
atcatactgactggtcccaaggagagtgccgactacttccgcgccatcgacgacttcgtc
aaggcgaccctgggggaaccggccacccgcctctaccggatcatcatcggcgatgcgccc
gaggtggctcgcgtcatgaaggaggccatgcccaagatccgcgaataccgcaagtctgtc
ggggatgcctactccttcaactggtccttgcggatcgagccggagttccagctgccattc
gagccggatcacgccagcatggccagcctggatctgcaccgcaaccagccaccccagctg
ctggctgccaacctgcgccgcgccttctccggcatagtcgccggcaacgtgaaggaaggg
ggcatccgcgccatcgagaagaagggccccttcaagctgcacggtgacaaggagctgatg
cacctgatggaccggctgctggagagtttcgtcagacagcaacggatgaagctgcccggc
agccaatacatcccctgctacgagatagtaaagtaa

DBGET integrated database retrieval system